KEGG   Caenorhabditis elegans (nematode): CELE_C36E6.3
Entry
CELE_C36E6.3      CDS       T00019                                 

Symbol
mlc-1
Name
(RefSeq) Myosin regulatory light chain 1
  KO
K12757  myosin regulatory light chain 12
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_C36E6.3 (mlc-1)
   04147 Exosome [BR:cel04147]
    CELE_C36E6.3 (mlc-1)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     CELE_C36E6.3 (mlc-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CELE_C36E6.3 (mlc-1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_9 EF-hand_5 SPARC_Ca_bdg UPF0154
Other DBs
NCBI-GeneID: 181776
NCBI-ProteinID: NP_510829
WormBase: WBGene00003369
UniProt: P19625
Position
X:join(17459230..17459232,17459492..17459626,17459675..17459807,17459862..17460010,17460064..17460156)
AA seq 170 aa
MSKAAKKKSSKKRSGSEAAQFDQKTIQEFKEAFGIMDQNKDGIIDKSDLKDLYASMGQIA
PDSQIDAMIKEASGPINFTVFLTLFGERLTGTDPEATIIGAFAMFDKKDCGKIKEDDLIK
ILQNKRGEPLDEDEVKAMYKGKPPIEGGEVDYKAFAHLITTGAQDELASA
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtccaaggccgccaagaagaagtcctcaaagaagcgctcgggatccgaggccgcccaa
ttcgaccagaagaccatccaggaattcaaggaggctttcggaatcatggatcagaacaag
gacggaataattgacaagtctgacctcaaggatctctacgcttccatgggacaaatcgcc
ccagacagccagatcgacgccatgattaaagaggcttccggaccaatcaacttcaccgtc
ttcctcacccttttcggagagagattgacaggaactgacccagaggccaccattattgga
gcctttgccatgttcgacaagaaggactgcggaaagatcaaggaggacgaccttatcaag
atccttcaaaacaagagaggagagccattggacgaggatgaggtcaaggctatgtacaag
ggaaagccaccaatcgagggaggagaggtcgactacaaggccttcgctcacctcattacc
accggagcccaagacgagctcgccagcgcctga

DBGET integrated database retrieval system