KEGG   Caenorhabditis elegans (nematode): CELE_C39B5.6
Entry
CELE_C39B5.6      CDS       T00019                                 

Symbol
C39B5.6
Name
(RefSeq) Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: GatB_N GatB_Yqey AAA_assoc_C
Other DBs
NCBI-GeneID: 183325
NCBI-ProteinID: NP_497510
WormBase: WBGene00016524
Ensembl: WBGene00016524
UniProt: Q9N5X5
Position
III:join(2198019..2198105,2199978..2200307,2202702..2202981,2204630..2204967,2205590..2205729,2206417..2206762)
AA seq 506 aa
MWQCRRLASTSAAATVTQKQRFRPVIGLEIHVQLNTLTKLFSRCPTSESSPNRRVDAFDM
ATPGILPALNRQCVLRALKMARILHCQVPKSSRFDRKHYFYADMPAGYQITQNEKPIAKN
GKFGFWVFDERIEVPYWKEVEILQLQLEQDSGKTIHMTSQAAPPTSLIDYNRAGCALVEI
VTSPCFTTAIEAIRFVQILRLLLIHHAICDGELHRGHIRVDANVSLAKDDVWGTRTEIKN
MNSIRTIHTAINYEIARQFEILKNGGAVQNETRAADSEGRTVSMRDKETEETDYRFMVEP
NLPQLKIHGKWLKEVEEELKCEGKADFEVLREDVGFDARSAVHIAEEPELLSFVKRCIRY
KAPTVTPVDILYWMKELKTVMQRSKANYPPQSEFFARQFTTLLKFSSEHRLTRLRLLDLL
RHYATDDDVMAGELEILIEENRYWRIRAPAEIDEIVRKSMEKQEKLVEKCRSGHVKSFNR
LRNSIIDSSNKCIELEDLEASIRRLL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgtggcagtgtaggcggttggcgtcaacttcggcggcggctacagtaacccagaagcag
cgattccggccggttattggattggagatccacgtacaactgaacaccctgacaaaacta
ttctcacgatgcccaacgtcagaatcgtcaccaaatcgacgagtcgacgcattcgatatg
gccacacccggcatcctaccggcactcaacaggcaatgtgtactccgtgcactgaaaatg
gctcgaattttgcactgtcaagtgcccaaatcgtcgagattcgaccgcaaacactatttc
tatgcggacatgccggccggctatcagatcactcaaaacgagaagcccatcgcgaaaaat
gggaaattcggattttgggtgttcgatgagcgcattgaggtgccgtattggaaggaggta
gaaattctacaactccaacttgagcaagattcgggaaaaaccatccatatgacgtcacaa
gcagctccgcccacatctctaatcgattataatcgtgccgggtgtgcacttgtcgagata
gtgacgtcaccatgcttcacaacagccatcgaagcgatcagatttgtgcaaattcttcgg
cttctgctcattcaccacgcgatttgtgacggagaactgcacaggggacatattcgagtt
gatgctaatgtttcactggcaaaggatgacgtttggggaacccgaacggaaatcaaaaat
atgaacagtatccgcacaattcacacggcaatcaactacgaaatcgcgcggcaatttgaa
attctaaaaaacggcggagcagtacaaaatgagacacgggcggccgattcggaaggacgg
acggtctcgatgagagataaggagacggaggaaacggattatcgatttatggttgaaccg
aaccttccacagctgaaaatccacggaaaatggctgaaagaagtggaagaagagctgaaa
tgcgagggaaaagccgattttgaagttttgcgggaagatgtcggatttgatgcgagaagt
gctgttcatatcgctgaagaacccgagctgctgagcttcgtaaaacgttgtatacgatac
aaggcacctacagtaaccccagtcgacatactgtattggatgaaagagctgaaaactgtt
atgcaaagatcaaaagccaattatccacctcaaagcgaattcttcgcccgtcaattcacc
acccttctcaaattctcatcagagcaccgtctaactcgcctgcgtctcctcgatcttcta
cgtcactatgcgactgatgatgacgtcatggccggcgagctggaaattttaatcgaagaa
aatcgatattggagaatacgggcgccggcggaaatcgacgaaatcgtgcgaaaatcgatg
gaaaaacaggaaaaattggtggaaaaatgccgaagtggacacgtgaaaagctttaatcga
ttgagaaattcgattattgattcttcgaataaatgcattgaattggaggatttagaagca
tcgattagaagattattataa

DBGET integrated database retrieval system