KEGG   Caenorhabditis elegans (nematode): CELE_C42C1.14Help
Entry
CELE_C42C1.14     CDS       T00019                                 

Gene name
rpl-34
Definition
(RefSeq) Ribosomal Protein, Large subunit
  KO
K02915  large subunit ribosomal protein L34e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Module
cel_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_C42C1.14 (rpl-34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_C42C1.14 (rpl-34)
Ribosome [BR:cel03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    CELE_C42C1.14 (rpl-34)
  Archaea
    CELE_C42C1.14 (rpl-34)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L34e
Motif
Other DBs
NCBI-GeneID: 178173
NCBI-ProteinID: NP_502330
WormBase: WBGene00004448
Ensembl: WBGene00004448
UniProt: A3QMC5
Position
IV:join(12269002..12269160,12269288..12269461)
Genome map
AA seq 110 aa AA seqDB search
MSLRVTYRRRLSYNTTSNKKRLVKTPGGRLVVQYIKKRGQIPKCRDTGVKLHGITPARPI
ALRLLKRNERTVTRAYGGCLSPNAVKERITRAFLVEEQKIVNKVIKHQKD
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccgcgttacctacagacgccgtttgtcgtacaacaccacctccaacaagaag
cgtcttgtcaagaccccaggaggacgtctcgttgtccaatacatcaagaagagaggacaa
attccaaagtgcagagacaccggagtcaagctccacggaatcaccccagctcgcccaatc
gctctccgccttctcaagagaaacgagcgtaccgtcaccagagcctacggaggatgcctc
tcaccaaacgccgttaaggagcgcattacccgtgctttcctcgtcgaggagcagaagatc
gtcaacaaggtcatcaagcaccagaaggactaa

DBGET integrated database retrieval system