KEGG   Caenorhabditis elegans (nematode): CELE_C42D8.8
Entry
CELE_C42D8.8      CDS       T00019                                 

Gene name
apl-1
Definition
(RefSeq) Amyloid-beta-like protein
  KO
K04520  amyloid beta A4 protein
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_C42D8.8 (apl-1)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:cel00535]
    CELE_C42D8.8 (apl-1)
   00536 Glycosaminoglycan binding proteins [BR:cel00536]
    CELE_C42D8.8 (apl-1)
Peptidases and inhibitors [BR:cel01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   CELE_C42D8.8 (apl-1)
Proteoglycans [BR:cel00535]
 Cell surface proteoglycans
  Others
   CELE_C42D8.8 (apl-1)
Glycosaminoglycan binding proteins [BR:cel00536]
 Heparan sulfate / Heparin
  Others
   CELE_C42D8.8 (apl-1)
SSDB
Motif
Pfam: APP_E2 APP_N APP_Cu_bd APP_amyloid ThiD2
Other DBs
NCBI-GeneID: 180783
NCBI-ProteinID: NP_508871
WormBase: WBGene00000149
Ensembl: WBGene00000149
UniProt: Q10651
Structure
PDB: 
3K66 3K6B 2M05

Position
X:complement(join(5113100..5113420,5113469..5113591,5113650..5113848,5113898..5114080,5114124..5114320,5114374..5114583,5114723..5114856,5114910..5115002,5115139..5115372,5115556..5115682,5116171..5116338,5116799..5116864))
AA seq 684 aa
MTVGKLMIGLLIPILVATVYAEGSPAGSKRHEKFIPMVAFSCGYRNQYMTEEGSWKTDDE
RYATCFSGKLDILKYCRKAYPSMNITNIVEYSHEVSISDWCREEGSPCKWTHSVRPYHCI
DGEFHSEALQVPHDCQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLE
PCALDMFTGVEFVCCPNDQTNKTDVQKTKEDEDDDDDEDDAYEDDYSEESDEKDEEEPSS
QDPYFKIANWTNEHDDFKKAEMRMDEKHRKKVDKVMKEWGDLETRYNEQKAKDPKGAEKF
KSQMNARFQKTVSSLEEEHKRMRKEIEAVHEERVQAMLNEKKRDATHDYRQALATHVNKP
NKHSVLQSLKAYIRAEEKDRMHTLNRYRHLLKADSKEAAAYKPTVIHRLRYIDLRINGTL
AMLRDFPDLEKYVRPIAVTYWKDYRDEVSPDISVEDSELTPIIHDDEFSKNAKLDVKAPT
TTAKPVKETDNAKVLPTEASDSEEEADEYYEDEDDEQVKKTPDMKKKVKVVDIKPKEVTI
EEEKKAPKLVETSVQTDDEDDDEDSSSSTSSESDEDEDKNIKELRVDIEPIIDEPASFYR
HDKLIQSPEVERSASSVFQPYVLASAMFITAICIIAFAITNARRRRAMRGFIEVDVYTPE
ERHVAGMQVNGYENPTYSFFDSKA
NT seq 2055 nt   +upstreamnt  +downstreamnt
atgacggtgggtaaactaatgattggcttacttataccgattcttgtcgccacagtttac
gcagagggttccccagcaggcagcaagcgacatgagaagttcattccaatggtcgcattt
tcatgtggataccgcaaccagtatatgaccgaagagggatcatggaagactgatgatgaa
cgatatgccacctgcttctctggcaaacttgacatcctcaagtactgccgcaaggcttat
ccatccatgaacatcaccaacatcgtcgaatactcgcacgaagtgagcatctccgactgg
tgccgcgaggaaggatcgccatgcaagtggactcacagtgtcagaccgtaccattgcatt
gacggagaattccactcggaagctcttcaagtcccgcacgactgtcaattctcgcacgtc
aactcgcgcgaccaatgcaacgactaccagcactggaaggatgaagctggaaagcagtgc
aagaccaagaagtccaagggcaacaaggatatgattgtcagatcatttgccgttcttgag
ccatgcgcactcgacatgttcaccggtgttgaattcgtctgctgtccaaatgaccaaacg
aacaagactgatgttcaaaaaactaaagaagacgaagacgacgacgacgatgaggatgat
gcttatgaggatgattactcagaagagtccgacgagaaggacgaagaggaaccaagttcc
caagatccatacttcaagattgccaactggaccaacgagcacgacgattttaagaaggca
gaaatgagaatggatgagaagcacagaaagaaggttgacaaggtgatgaaggagtgggga
gatttggagacgagatacaacgagcaaaaggccaaggatccaaagggagccgagaagttc
aagtctcaaatgaacgcccgcttccagaagaccgtttcttcgctcgaagaagagcacaag
agaatgcgaaaggagatcgaggcggttcatgaggagcgtgttcaggcaatgcttaacgag
aagaagagagatgctacacacgattatcgtcaagctctcgctactcacgtcaacaagcca
aacaagcactctgttctccaatctcttaaggcttacatccgtgcagaggagaaggatcgc
atgcacactttgaacagataccgtcacttgctgaaggccgattcaaaggaagctgccgca
tacaagccaaccgttattcatcggcttcgctacatcgatcttcgcatcaacggaactctt
gcgatgcttcgcgacttcccagatcttgagaaatatgtccgtccaattgcagtcacctac
tggaaggactacagagacgaggtgtcaccagatatctcagttgaggacagtgaactcact
ccaatcatccacgatgatgagttcagcaaaaacgccaaacttgacgtgaaggctccaaca
accaccgccaagccagtcaaggaaaccgacaatgctaaggttctcccaaccgaagcatct
gactccgaggaggaagctgatgaatattacgaggatgaagatgatgagcaagttaagaag
acacctgacatgaagaagaaggtcaaggttgttgacatcaagccaaaggaggtcacaata
gaagaggagaagaaggctccaaaattggtggaaacatcagtacaaactgatgatgaggac
gatgatgaggactcttcctcgtccacttcatccgaatctgatgaagatgaagacaaaaac
atcaaagagcttcgtgtcgacattgagccgatcatcgatgagccagcctcattctaccgc
cacgacaagctcatccaatcaccagaagtcgagcgttcagcgtccagcgtcttccaacca
tacgtcctggcatcggcgatgttcatcaccgctatctgcatcatcgcctttgccatcacc
aacgctcgtcgtcgccgtgccatgcgcggtttcatcgaggtagacgtctacacaccagag
gagcgtcatgtcgctggaatgcaagtcaatggctatgaaaacccgacgtactcattcttc
gactcgaaggcctaa

DBGET integrated database retrieval system