KEGG   Caenorhabditis elegans (nematode): CELE_C43F9.8
Entry
CELE_C43F9.8      CDS       T00019                                 

Gene name
efn-2
Definition
(RefSeq) Ephrin RBD domain-containing protein
  KO
K05463  ephrin-B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C43F9.8 (efn-2)
   04052 Cytokines and growth factors [BR:cel04052]
    CELE_C43F9.8 (efn-2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CELE_C43F9.8 (efn-2)
Cytokines and growth factors [BR:cel04052]
 Growth factors
  Growth factors (RTK binding)
   CELE_C43F9.8 (efn-2)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 177949
NCBI-ProteinID: NP_501955
WormBase: WBGene00001163
Ensembl: WBGene00001163
UniProt: Q9U3M2
Position
IV:join(10576389..10576483,10577140..10577332,10577521..10577605,10577663..10577872,10577954..10578027)
AA seq 218 aa
MQIATFILLSLFPFIGWARKIPDINWISSNPIFDVSNTDHVISVHIGDRVSIRCPKSDET
GKYEYSYIYMVSDEEYDHCFLSKPRLVGACDNQTINASINIVFRSFTPTPGGFEFQPGKN
YFLISTSDGTLEGIDRKKDGLCTAKQMKIKFEVGQDRRGIENPKFAARTLKKDRDAEHST
PVMYVVHDESDIDDDDDGSNACSYFVSIVVLLASRYLL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcagattgccacgttcatcttgctttccttattcccatttattgggtgggctcgcaag
attcctgatatcaattggatatcatctaatccaatctttgacgtatcgaatacggatcat
gtgatatcagttcatattggcgatcgagtttcaataagatgcccgaagtcagatgaaact
ggaaaatatgagtattcgtacatttatatggtttccgatgaagaatacgatcactgtttc
ttatcaaaaccaagacttgtaggagcttgtgataaccagacaattaatgcatcaataaac
attgtgtttcgatcgttcacccctacacctggcggctttgagtttcaacctggaaagaat
tatttccttatcagcacttcagacggcacattagaaggaattgataggaaaaaagatggt
ctttgtacggcaaaacaaatgaaaataaaatttgaagttgggcaagataggcgaggaatt
gagaatccaaaatttgcagctcgaactttgaaaaaagatcgagatgcagaacattcgaca
cctgtcatgtacgtggtacatgatgagagcgatattgatgacgatgacgacggctccaac
gcttgctcgtatttcgtttcgatcgtcgttttgctagcatctcgataccttctctaa

DBGET integrated database retrieval system