KEGG   Caenorhabditis elegans (nematode): CELE_C44C8.6
Entry
CELE_C44C8.6      CDS       T00019                                 

Gene name
mak-2
Definition
(RefSeq) MAP kinase-activated protein kinase mak-2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_C44C8.6 (mak-2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C44C8.6 (mak-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_C44C8.6 (mak-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_C44C8.6 (mak-2)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   CELE_C44C8.6 (mak-2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 176914
NCBI-ProteinID: NP_001367654
WormBase: WBGene00007007
Ensembl: WBGene00007007
Position
IV:join(886563..886613,887289..887668,888073..888261,888313..888437,888558..888844,889826..889894)
AA seq 366 aa
MAFHEYPVTQDYRISRKVLGVGINGKVVECEHRQSGDKFALKVLRDTQKARREVELHVMA
SGHGHVVSVHDVYKNSYNGVDCLLVVMENMKGGELFNRIQERGQKAFTEREAAGIVNEIC
SAVAHLHRMSIAHRDLKPENLLYVTTASNAALKLTDFGFAKKTDESEPQGLKTACFTPYY
CAPEVLGTEKYDKSCDLWSIGVIMYILLCGYPPFYSQHGQPMSPGMKAKIKSGQYTFPSP
EWDCVSEAAKDLIRKLLRTEPTERITIEQTMEHKWISHYRRVPDTPLFTSSNLNDQREQW
TDMQDEMEATLASMRVGPENIQIKSLGDSNNKLLAKRRKGGASPKDDPMDDIKEEEKDDE
EEKMIS
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcttttcatgagtatcctgttactcaggactatcgaattagtcggaaggttctcggc
gtaggaatcaacggaaaagttgtggaatgtgagcaccgccagtcgggcgacaaattcgcg
ctaaaagtgctccgagacacacagaaagctcgtcgagaagtcgaacttcacgtgatggct
tcaggacacggccacgtggtttcagtgcacgatgtgtacaagaattcatataacggagtc
gattgtctgctcgttgtgatggaaaatatgaagggtggagagctgttcaatcggattcag
gagcgaggtcagaaggcgtttaccgagagagaagctgctggaattgttaacgaaatttgc
tcggcggttgctcatttgcatcgaatgagcattgcgcatagggatctgaaaccggagaat
ttactttatgtcaccacagcttccaacgccgctctgaaactcacagatttcggattcgcc
aaaaaaacagatgaatcggaaccccaaggcctaaaaacggcgtgcttcaccccttactat
tgtgctccggaagtgctcggcaccgaaaaatatgataaatcttgtgatttatggtcgatc
ggagttattatgtatattttactgtgcggctacccaccattttactctcaacacggacaa
ccaatgtcacctggaatgaaggcgaaaatcaagtcaggacagtacacatttccgagtccc
gaatgggattgtgtttctgaagcagccaaagacctaatccgaaagcttctccgaactgag
cccactgaacgtatcacaattgagcagacaatggagcacaagtggatatctcattaccgt
agagttccagatactccattattcacaagttcaaatctgaacgatcaacgggaacaatgg
acggatatgcaggatgaaatggaggctacattggcctcaatgagagttggtcctgaaaat
attcagattaaaagccttggagactcgaataataagcttttggcgaagaggagaaaaggt
ggagctagtccgaaagacgatcccatggacgatatcaaggaggaggaaaaggacgatgaa
gaggaaaaaatgatttcctag

DBGET integrated database retrieval system