KEGG   Caenorhabditis elegans (nematode): CELE_C45H4.17Help
Entry
CELE_C45H4.17     CDS       T00019                                 

Gene name
cyp-33C2
Definition
(RefSeq) CYtochrome P450 family
  KO
K17955  cytochrome P450 family 33
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cel00199]
    CELE_C45H4.17 (cyp-33C2)
Cytochrome P450 [BR:cel00199]
 Cytochrome P450, animal type
  CYP33 family
   CELE_C45H4.17 (cyp-33C2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 178695
NCBI-ProteinID: NP_503594
WormBase: WBGene00016697
Ensembl: WBGene00016697
UniProt: O44706
Position
V:join(2183521..2183719,2183851..2184212,2184269..2184573,2184626..2184836,2186074..2186385,2186437..2186535)
Genome map
AA seq 495 aa AA seqDB search
MLIILLLTVLTVYLVYELYWKRRNFPPGPCPLPVFGNLLSIANPPPGYEAFERWTKKYGD
IYTFWIGNTPHIMINTWDKIKETYIRDAETYTNKVRLPALDLFRGGEYGIIDSNGATWRE
HRRFALSTMRDFGLGKNLMQENILMEVQDVFARLDAKLGSETDIPEVFDHAVANVVNQLL
FGYRFVGPKESEYQELKRIIEAPTDLFGKPHMFLAMNIPVIAKLMPEFMYEGPFKDFRDT
AFAFFNKQIEAHRQEVDLNDLNSESTDFVETFLKEQKRRESEGDSETFSNVQLSNVCMDL
WFAGLNTTTNTITWAISYILHHPEVQDKVHEEMDKVIGSDRLITTADKNDLPYFNAFINE
AQRGINIVPLNLQHATTRDTVINGFKIPKGTGVVAQISTVMNNEEVFPDPHTFNPDRFID
EHGKLKRVEELAPFSVGKRSCPGEGLARMELFLFIANFLNRYKIYPSKEGPPSMDKSNGA
LIAPRLFSATLKRRS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgttgattattttgttattgactgttctcactgtctaccttgtttatgagttgtattgg
aagcggaggaactttccacccgggccatgtccgctgccagtttttgggaatttgttgtct
atcgcgaatccaccaccggggtatgaagcgttcgagagatggactaagaaatatggagat
atttatactttctggattggtaacactcctcacatcatgatcaacacatgggacaagatc
aaagagacatacatccgtgacgccgaaacctacacgaataaggtccgactacctgcgttg
gacctgttccgcggtggcgagtacggaatcatcgactcgaatggtgccacttggcgagag
cacagacgattcgcactttctacgatgcgagattttggtcttgggaaaaatttgatgcag
gaaaatattctgatggaggtgcaggatgtttttgcgaggctagatgcaaaactgggatcc
gagaccgatattccagaagtttttgatcatgctgttgcaaatgtggttaatcaacttctt
tttggatatcgcttcgtggggcccaaagaaagtgaataccaagaattgaaacgaattatt
gaggcacccactgatctattcggaaaaccacacatgttccttgccatgaacattccagta
attgcaaagctgatgccagaatttatgtacgaagggccattcaaagacttccgagatact
gcatttgcatttttcaataagcaaattgaggcccatcggcaagaagttgatttgaatgat
ttgaactcggagagcacagatttcgtagagacttttttgaaagagcagaaaagacgtgaa
agcgagggtgattcggagactttcagtaatgtccaactttcaaatgtttgcatggacctt
tggttcgcgggtcttaacactacaactaatacaattacatgggcaatcagctacattttg
catcatccagaggttcaggacaaggttcatgaggaaatggacaaagtgattggaagtgat
agacttatcaccacagctgataaaaatgatctaccgtacttcaacgcgtttatcaatgaa
gcgcaacgtggaatcaacattgtccctctgaacctccagcacgcaaccacccgtgatact
gtaataaatgggttcaaaatcccgaaagggactggagtggtcgcccagattagtactgtt
atgaataatgaggaagtgtttccggacccgcacactttcaatccagacagatttattgat
gagcacggaaaattgaagagagtcgaggagctcgccccgttctcagttggaaaacgaagt
tgcccgggagaaggactcgctcgaatggagcttttcctttttattgccaattttttgaat
agatacaagatctacccatctaaggagggcccaccgtcaatggataagagcaatggagcc
ctgattgctccgagattattctccgcgactttaaagagaagatcataa

DBGET integrated database retrieval system