KEGG   Caenorhabditis elegans (nematode): CELE_C47E8.5Help
Entry
CELE_C47E8.5      CDS       T00019                                 

Gene name
hsp-90
Definition
(RefSeq) Heat shock protein 90
  KO
K04079  molecular chaperone HtpG
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_C47E8.5 (hsp-90)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cel01009]
    CELE_C47E8.5 (hsp-90)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_C47E8.5 (hsp-90)
   04131 Membrane trafficking [BR:cel04131]
    CELE_C47E8.5 (hsp-90)
   03051 Proteasome [BR:cel03051]
    CELE_C47E8.5 (hsp-90)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_C47E8.5 (hsp-90)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C47E8.5 (hsp-90)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CELE_C47E8.5 (hsp-90)
Chaperones and folding catalysts [BR:cel03110]
 Heat shock proteins
  HSP90
   CELE_C47E8.5 (hsp-90)
Membrane trafficking [BR:cel04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CELE_C47E8.5 (hsp-90)
Proteasome [BR:cel03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CELE_C47E8.5 (hsp-90)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    CELE_C47E8.5 (hsp-90)
Exosome [BR:cel04147]
 Exosomal proteins
  Proteins found in most exosomes
   CELE_C47E8.5 (hsp-90)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 179971
NCBI-ProteinID: NP_506626
WormBase: WBGene00000915
Ensembl: WBGene00000915
UniProt: Q18688
Structure
PDB: 

Position
V:join(14686164..14686313,14686361..14687065,14687114..14688099,14688158..14688425)
Genome map
AA seq 702 aa AA seqDB search
MSENAETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTEPSELDT
GKELFIKITPNKEEKTLTIMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIG
QFGVGFYSAFLVADKVVVTSKNNDDDSYQWESSAGGSFVVRPFNDPEVTRGTKIVMHIKE
DQIDFLEERKIKEIVKKHSQFIGYPIKLVVEKEREKEVEDEEAVEAKDEEKKEGEVENVA
DDADKKKTKKIKEKYFEDEELNKTKPIWTRNPDDISNEEYAEFYKSLSNDWEDHLAVKHF
SVEGQLEFRALLFVPQRAPFDLFENKKSKNSIKLYVRRVFIMENCEELMPEYLNFIKGVV
DSEDLPLNISREMLQQSKILKVIRKNLVKKCMELIDEVAEDKDNFKKFYEQFGKNLKLGI
HEDSTNRKKLSDFLRYSTSAGDEPTSLKEYVSRMKENQTQIYYITGESKDVVAASAFVER
VKSRGFEVLYMCDPIDEYCVQQLKEYDGKKLVSVTKEGLELPETEEEKKKFEEDKVAYEN
LCKVIKDILEKKVEKVGVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAA
KKHLEINPDHAIMKTLRDRVEVDKNDKTVKDLVVLLFETALLASGFSLEEPQSHASRIYR
MIKLGLDIGDDEIEDSAVPSSCTAEAKIEGAEEDASRMEEVD
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaacgccgaaaccttcgcattccaggctgagattgctcagttgatgagcttg
atcatcaacactttctacagtaacaaggaaatctacttgcgtgaattgatctcaaacgcc
tccgatgctcttgacaagattcgctaccaggcactcaccgagccatccgagcttgacact
ggaaaggaattgttcatcaaaattactccaaacaaggaggaaaagacccttaccattatg
gataccggaatcggaatgaccaaggccgatcttgtcaacaaccttggaaccattgccaag
tctggaaccaaggccttcatggaggctcttcaagctggagctgatatttccatgattggt
cagttcggagtcggattctactctgctttccttgtcgccgataaggttgtcgtcacatcc
aagaacaacgatgatgacagctatcaatgggagtcttccgcaggaggttctttcgtcgtt
cgtccattcaatgacccagaggtcacccgtggaacgaagattgtcatgcacatcaaggag
gatcagattgacttcctcgaggagcgcaagatcaaggagatcgttaagaagcattctcag
ttcatcggatacccaatcaagcttgtggttgagaaggagcgtgagaaggaggttgaagat
gaggaggctgtcgaggctaaggatgaggagaagaaggagggagaggtcgagaacgtcgct
gacgacgctgacaagaagaagaccaagaaaatcaaggagaagtacttcgaagacgaagag
cttaacaagaccaagccaatctggaccagaaacccagacgatatctccaacgaagaatat
gctgagttctacaagagcttgtccaatgactgggaagatcatcttgccgtcaagcatttc
tccgttgagggacaacttgaattccgtgctcttctcttcgtcccacaaagagctccattt
gatctcttcgagaacaagaagagcaagaactccatcaagctctacgttcgtcgtgtcttc
atcatggagaactgcgaagagctcatgccagaataccttaacttcatcaagggagtcgtc
gattctgaggatcttccacttaacatctctcgtgaaatgctccagcaatccaagatcttg
aaggtcatccgtaagaatcttgtcaagaagtgcatggagcttatcgacgaggttgccgag
gacaaagacaacttcaagaagttctacgagcaattcggaaagaatctcaagctcggaatc
cacgaggactctactaaccgcaagaagctttccgatttccttcgctactctacctccgct
ggagatgagccaacttccctcaaggaatacgtttcccgcatgaaggagaaccaaactcaa
atctactacatcaccggagagtccaaggatgttgttgctgcttcagctttcgtcgagcgt
gttaagagccgcggattcgaagtcctctacatgtgcgacccaattgatgagtactgcgtc
caacaactcaaggagtatgatggaaagaagcttgtctccgtcaccaaggaaggactcgag
ctcccagaaaccgaggaggagaagaagaagttcgaagaggacaaggttgcctacgaaaac
ctttgcaaggtcatcaaggacattttggagaagaaggttgagaaggttggagtttctaac
cgtcttgtctcttccccatgctgcattgtcacttccgagtacggatggtccgctaacatg
gagcgcatcatgaaagctcaagctcttcgtgattcctctactatgggatacatggccgcc
aagaagcatctcgaaatcaacccagaccacgctatcatgaagacacttcgtgatcgtgtc
gaggtcgataagaatgacaagaccgttaaggatttggttgttcttcttttcgagactgct
cttctcgcttccggattctcccttgaggagccacaatctcacgcttcccgcatctacaga
atgatcaagcttggtctcgatatcggagatgacgaaattgaagattctgctgttccatca
tcgtgcaccgctgaggccaagattgagggagctgaggaggatgcttcccgcatggaggag
gtcgactaa

DBGET integrated database retrieval system