KEGG   Caenorhabditis elegans (nematode): CELE_C48B4.6
Entry
CELE_C48B4.6      CDS       T00019                                 

Gene name
C48B4.6
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: DUF5373
Other DBs
NCBI-GeneID: 183566
NCBI-ProteinID: NP_499109
WormBase: WBGene00008169
Ensembl: WBGene00008169
UniProt: P34360
Position
III:complement(join(9557561..9557706,9557752..9557832,9557880..9558012,9558382..9558552))
AA seq 176 aa
MSKTAALTDIEKSKATISFWKFIAMFIQALFLIGLVEDLCYYHMFYSRQYFFLEILVTIH
TGFSFIVFLIEHKPLIMLHVGYMTLLTIIPIAYMVMQGVEFGILIFDDYHILVFRDFHKF
GCSIMFSLYYIGYIVVCFLFIEALEKKPVLPQVYSIKPKLVAAVNPSNNCNVYPML
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtcgaaaaccgccgctctcaccgatattgaaaagtcaaaggcgacgatttccttctgg
aaattcatagccatgttcattcaagctctttttctcatcggacttgttgaagatctctgc
tattaccatatgttctatagcagacaatatttcttcctcgaaatcctcgtgacaattcac
accggattttcgttcatcgtgttcctcattgagcacaagcctctcatcatgctccatgtc
ggttacatgactcttctgaccatcattccgattgcttatatggtcatgcagggtgttgag
tttggaatcctcatcttcgatgactatcacattctcgttttccgcgattttcataagttt
ggatgttccatcatgttctccctatactacattggatacattgtcgtgtgcttcctgttc
atcgaagctctcgaaaagaaaccagttctcccacaggtttattcgatcaagccaaagctt
gttgccgcggttaatccatcgaataattgcaatgtttacccaatgctctga

DBGET integrated database retrieval system