KEGG   Caenorhabditis elegans (nematode): CELE_C49A1.3
Entry
CELE_C49A1.3      CDS       T00019                                 

Gene name
best-11
Definition
(RefSeq) Bestrophin homolog
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 173292
NCBI-ProteinID: NP_493482
WormBase: WBGene00008186
Ensembl: WBGene00008186
UniProt: O17671
Position
I:complement(join(14216756..14216942,14216991..14217157,14217207..14217356,14218377..14218577,14218622..14218931,14219756..14219893,14219940..14220064,14220122..14220178))
AA seq 444 aa
MTIAYYARLNKIAIWNSFMIVFAFWKGSIWKIILDEVGTWYLIYLCIAGIYRFYLSAEQQ
EIFSSFIRDLQDKHNVCVPMQFMLGYFIGMVGERWGESFENVSYIEKVALSVAAFIPGVV
NIHNRRNIIRYMVLSQILGIRQISALVKKRFPNNDALVTAGLLHETERKKLEKVPCAVYA
ESFVPIIWALKILQKYEEAEERTFKADNPREEFGGTGVYDTVYAEITEFHEKTATLSTYD
TTPIPLAYSQIVIFSVRLYFFICLFTRQHLDMDDTYLELVFSLFPLLTIMQFIFMVGCMK
VSSVLINPMGEDDDNYECNYVFDRNLFVGMEIVGWVKENPAKTHPDLDGRNIIDIDNRPY
YPKYGDKFDGKNKAYVGSYKHVPFPHKAMSKLPLDAQQVQGKKKRVGTCLSCNLTLKEPN
TSAEEPEAAIVASPGAVVLHVQPQ
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgacaattgcttattatgcaagactcaataagatcgctatatggaattctttcatgatt
gttttcgctttctggaaaggatcgatttggaaaattattctcgatgaagttggcacttgg
tatctaatttatttatgcatcgcaggcatctatagattttatttgtcggcggaacaacaa
gaaattttctcctcatttatcagagatctacaggataaacataatgtctgcgttccaatg
caattcatgctcggatactttatcggaatggttggcgagcggtggggagagtcgttcgaa
aatgttagctatattgagaaagttgctctatcagttgccgccttcatcccgggagttgtg
aacattcataaccggcgtaacatcattcgttatatggttttatcgcaaattctcggcatc
cgacaaatatctgcactggtgaagaagcgattcccgaataatgatgcgctggtcaccgcc
ggacttttgcatgaaaccgagcggaaaaaactggaaaaagtgccatgtgcggtgtacgcg
gagtcgtttgttccaatcatctgggcgctgaaaatactgcagaaatatgaagaggcagag
gagaggacgttcaaggcggacaatcccagggaggaatttggtgggactggtgtatatgac
actgtgtacgcagagattacggagtttcatgaaaaaacagcgactctttccacctatgac
accactccgattcccctggcatactcgcagattgtcatcttttcggtcagattgtacttc
tttatttgtctgttcacaagacaacatttggatatggatgacacttatctggaactggtt
ttctccctgttcccactcctcaccatcatgcagttcattttcatggtgggatgtatgaag
gtttcgtcggtcttgatcaacccaatgggagaggacgatgacaattacgagtgcaattat
gtttttgatagaaatttatttgttggaatggaaattgtgggatgggttaaagagaatccg
gcaaaaacacacccggatctggatggcaggaacattattgatatagataaccgaccgtat
tatccgaaatatggagacaaatttgatggaaagaataaggcgtatgtggggtcttataaa
catgtcccattcccacataaagcaatgagcaagcttccgctagatgcacaacaggtccaa
ggaaaaaagaagcgcgtcggcacatgtttgagttgcaacttgaccttgaaagagcctaac
acgtcagcagaggagccagaagcagcaattgtagcatcaccgggagctgttgttttgcat
gtacagccacagtag

DBGET integrated database retrieval system