KEGG   Caenorhabditis elegans (nematode): CELE_C50F4.5Help
Entry
CELE_C50F4.5      CDS       T00019                                 

Gene name
his-41
Definition
(RefSeq) Probable histone H2B 3
  KO
K11252  histone H2B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    CELE_C50F4.5 (his-41)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_C50F4.5 (his-41)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W Endonuc-HincII DUF1931
Motif
Other DBs
NCBI-GeneID: 179340
NCBI-ProteinID: NP_505464
WormBase: WBGene00001915
Ensembl: WBGene00001915
UniProt: Q27484
Position
V:join(9545579..9545713,9545928..9546164)
Genome map
AA seq 123 aa AA seqDB search
MAPPKPSAKGAKKAAKTVSKPKDGKKRKHARKESYSVYIYRVLKQVHPDTGVSSKAMSIM
NSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaaaaccatcagctaaaggagccaaaaaggctgctaagaccgtcagcaag
ccaaaagacggaaagaaaagaaagcatgctcgtaaggaatcctactcggtctacatctac
cgtgttttaaagcaggttcacccagacaccggtgtgtcatccaaggctatgtcgatcatg
aattcgtttgtcaacgatgtcttcgagagaattgcttcggaagcatctcgtctggcccac
tacaacaagagatccaccatctcttctcgcgaaatccaaaccgctgtccgtctcattctt
cctggagaacttgcaaagcatgctgtttcagaaggaaccaaggctgtcaccaagtacact
tccagtaaataa

DBGET integrated database retrieval system