KEGG   Caenorhabditis elegans (nematode): CELE_C50F4.7Help
Entry
CELE_C50F4.7      CDS       T00019                                 

Gene name
his-37
Definition
(RefSeq) Histone H4
  KO
K11254  histone H4
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_C50F4.7 (his-37)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    CELE_C50F4.7 (his-37)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CENP-T_C CENP-S TAF CBFD_NFYB_HMF Histone Bromo_TP TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 179341
NCBI-ProteinID: NP_505466
WormBase: WBGene00001911
UniProt: P62784
Position
V:join(9547134..9547229,9547304..9547519)
Genome map
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggaaagggaggaaaaggacttggaaagggaggtgctaaacggcatcgt
aaagttcttcgtgacaacatccagggaatcacaaagccagcaattcgccgtctcgctcgt
cgtggtggagtcaaacgtatctctggacttatctacgaggaaactcgtggagttctgaag
gtcttccttgaaaatgtcattcgtgatgctgtcacttactgtgagcacgccaaaagaaag
actgtaaccgcgatggacgttgtctatgccttgaaacgtcaaggaagaactctctacgga
ttcggtggataa

DBGET integrated database retrieval system