KEGG   Caenorhabditis elegans (nematode): CELE_C52E4.5Help
Entry
CELE_C52E4.5      CDS       T00019                                 

Gene name
mans-2
Definition
(RefSeq) Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00510  N-Glycan biosynthesis
cel01100  Metabolic pathways
cel04141  Protein processing in endoplasmic reticulum
Module
cel_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    CELE_C52E4.5 (mans-2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_C52E4.5 (mans-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_C52E4.5 (mans-2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     CELE_C52E4.5 (mans-2)
Membrane trafficking [BR:cel04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    CELE_C52E4.5 (mans-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_47
Motif
Other DBs
NCBI-GeneID: 179642
NCBI-ProteinID: NP_001256389
WormBase: WBGene00008258
Ensembl: WBGene00008258
UniProt: Q18788
Position
V:complement(join(11983143..11983286,11983334..11983784,11983834..11984268,11984332..11984665,11985067..11985475))
Genome map
AA seq 590 aa AA seqDB search
MKTVRFNKQALAILAACFIFLLCVVCYFSASSESHNAVVVGERARGHIAVRDVENRHLAE
EKHAVIHAKTVGKIERVVSQEKVEILRPARVESKPPGEKTSTEPEETGVGKAPIQTSEGL
EKLIGKIHYENKDEENDLRRQKVKEMMIHAWEGYKNYSWGANELRPMSKKPNSQNIFGGS
QMPATIVDAADTLFIMDLKDKYKEARDYIENNFSMAKSTSTLSVFETTIRFLGGLLSLYA
LTQESFYIEKAREVGEALLPAFNTPSGIPKSNLDVASKHASNYGWANGGQSILSEIGSLH
LEFLYLSRISNAPIFEKKVKKVRDALEKAEKPNGLYSNYINPDTGKFTGSHMSLGALGDS
FYEYLIKSYVQSNYTDTQAKNMYWDVSDAIQKHMIKVSKQSNLTYTVELNNGQAQHKMGH
LACFVPGMFALQAINEDTEEEKLRIMTLAEELAKTCHESYIRSETHIGPEMFYFNERDEA
TSKHSENGYIQRPEVIEGWFYLWRLTGKTMYRDWVWDAVQAIEKYCRVDSGFTGLQNVYN
PKAGREDVMQSFFLAEFLKYAYLTFADESLISLDKWVFNTEAHPVPVLTN
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtacggttcaataaacaggcactagccattcttgctgcctgtttcatattt
cttctatgcgtcgtttgctacttttctgcatcttcggaatctcataatgcagtagttgtt
ggtgaaagagcacgtggtcatattgcagtgcgagatgttgagaatcgacatttagcagaa
gaaaaacatgctgtaattcatgcaaagacggttggaaaaattgaacgggttgttagccag
gagaaagtcgagattttgagacctgctagggttgagtccaaacctccaggtgagaaaacc
agcacagaaccagaagaaactggagttgggaaagctccgattcagacatcagaaggattg
gagaagcttattggaaagattcattatgaaaataaagatgaagaaaatgatctccgtcgt
caaaaagtaaaagaaatgatgattcatgcttgggaaggatacaaaaactactcgtgggga
gcaaatgaattaaggccaatgtccaaaaaaccaaattcccaaaacatttttggaggaagt
cagatgcctgcaacaattgttgatgcagctgatacattgtttattatggatttgaaagat
aaatataaggaagctagagattacattgaaaacaacttctcaatggccaagtctacgtca
acactttcagttttcgagacgactattcgctttttgggaggtcttctttcgttgtatgct
ttgacgcaggagtcattttatattgaaaaagctagggaagttggagaagctttacttcca
gctttcaatacaccatctggaattccaaaaagtaatttggatgtagcatcaaaacatgca
agtaactatggatgggctaatggaggacaatcaattctttccgaaattggaagtcttcat
cttgaattcctgtatctcagtagaatttccaatgctccaatttttgagaagaaagtgaag
aaagtgagagatgctcttgaaaaagctgaaaaacctaatggactctactcaaactacatt
aatccggatacaggaaaattcacaggaagtcatatgtcccttggagcacttggtgattca
ttttatgaatatcttatcaagagttatgttcaatcaaattatactgatacgcaagctaag
aatatgtattgggacgtcagtgatgctattcagaaacacatgattaaagtttccaaacaa
tcaaatcttacatacacagttgagttgaacaatggtcaagctcaacataaaatgggacat
ctcgcttgttttgtacctggaatgtttgctctacaagccatcaacgaggatactgaagaa
gagaaattaagaattatgacattggcggaagagttggcgaaaacctgccatgaaagctat
attcgttccgagacccacattggacctgaaatgttctacttcaatgaacgtgacgaagca
accagtaaacactcggaaaatggatatattcaaagaccagaagtcattgaaggatggttc
tatttatggagattaactggaaaaacaatgtatagagattgggtatgggatgctgttcaa
gctattgagaagtactgtagagttgatagtggatttactggtctacaaaatgtttataat
cctaaagctggccgtgaggacgtgatgcaatccttcttccttgccgagtttctgaagtat
gcctatttgacgtttgcagacgaatcactgatttcactcgataaatgggtatttaatacc
gaagctcacccggttccagtcttaactaattag

DBGET integrated database retrieval system