KEGG   Caenorhabditis elegans (nematode): CELE_C56G7.1
Entry
CELE_C56G7.1      CDS       T00019                                 

Symbol
mlc-4
Name
(RefSeq) Myosin regulatory light chain
  KO
K12757  myosin regulatory light chain 12
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_C56G7.1 (mlc-4)
   04147 Exosome [BR:cel04147]
    CELE_C56G7.1 (mlc-4)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     CELE_C56G7.1 (mlc-4)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CELE_C56G7.1 (mlc-4)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 UPF0154 SurA_N_2 SPARC_Ca_bdg AF0941-like DUF3741 DUF3216 AA_kinase
Other DBs
NCBI-GeneID: 175440
NCBI-ProteinID: NP_497700
WormBase: WBGene00003372
Ensembl: WBGene00003372
UniProt: Q09510
Position
III:complement(join(3392691..3392762,3393217..3393564,3393683..3393781))
AA seq 172 aa
MASRKTVNRRQRPQRATSNVFAMFDQAQIQEFKEAFNMIDQNRDGFIDQEDLKDMFASLG
KEVTEQFIDSMINEAPGAQPINFTMFLTLFGEKLTGTDPEEVIRNAFQCFDEDNSGKLNE
EHLRELLTTMGERYSEEQVDELFRDAPIKGGQFDYVEFTRMLKHGTKDKDEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcctcccgcaaaaccgtaaaccgccgtcaacggccacaaagagccacttccaatgtg
ttcgccatgttcgatcaggctcaaattcaagagttcaaagaggcattcaacatgatcgac
caaaaccgcgatggattcatcgatcaagaggatctgaaggatatgttcgcttcccttgga
aaagaagtcaccgaacaattcatcgattcgatgattaacgaggctcccggagcacagccg
atcaatttcacaatgttcctgacacttttcggtgaaaaattgactggaacggatccggag
gaagtcatacggaatgcgttccaatgcttcgatgaggataattcgggaaaactcaatgag
gagcatcttcgcgagttgctcaccacgatgggcgagagatattccgaggaacaggttgat
gagctctttagagatgctccgattaagggcggacaattcgactacgtggagttcactcgt
atgctcaaacacggaaccaaggacaaggatgaggcttaa

DBGET integrated database retrieval system