KEGG   Caenorhabditis elegans (nematode): CELE_D1007.6Help
Entry
CELE_D1007.6      CDS       T00019                                 

Gene name
rps-10
Definition
(RefSeq) Ribosomal Protein, Small subunit
  KO
K02947  small subunit ribosomal protein S10e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_D1007.6 (rps-10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_D1007.6 (rps-10)
Ribosome [BR:cel03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    CELE_D1007.6 (rps-10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S10_plectin DNA_pol_viral_N
Motif
Other DBs
NCBI-GeneID: 172061
NCBI-ProteinID: NP_491398
WormBase: WBGene00004479
Ensembl: WBGene00004479
UniProt: O01869
Position
I:complement(join(4583942..4584060,4584109..4584295,4584348..4584491))
Genome map
AA seq 149 aa AA seqDB search
MFIPKSHTKLIYEYLFNEGVTVAKKDFNAKTHPNIEGVSNLEVIKTLKSLASRELVKEQF
AWRHYYWYLTDAGILYLREYLALPAEIVPATIKTKPREIRVPHEDRAPRAAQGEKGDREA
YRTEKVTEAGPGGAPVYRAGFGRGAPPPQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcccgaaaagccacaccaagctcatctatgagtacctcttcaacgagggagtg
actgtcgccaagaaagacttcaatgccaagactcacccaaacatcgagggagtttccaac
cttgaggtcatcaagactttgaagtctcttgcctcccgcgagttggttaaggagcaattt
gcctggcgccactactactggtacttgaccgacgccggaatcttgtacctccgtgagtac
ctcgctcttccagctgagatcgtcccagccaccatcaagaccaagccaagagagatccgt
gtcccacacgaggatagagccccacgcgccgctcaaggcgagaagggagaccgtgaagcc
tacagaaccgagaaggtcaccgaggctggaccaggaggagccccagtctacagagccgga
ttcggccgtggagccccaccaccacaataa

DBGET integrated database retrieval system