KEGG   Caenorhabditis elegans (nematode): CELE_D1037.2
Entry
CELE_D1037.2      CDS       T00019                                 

Symbol
smp-2
Name
(RefSeq) Sema domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Sema PSI PSI_integrin
Other DBs
NCBI-GeneID: 183905
NCBI-ProteinID: NP_491197
WormBase: WBGene00004890
Ensembl: WBGene00004890
UniProt: Q9TYS4
Position
I:complement(join(3667124..3667325,3667835..3667916,3667966..3668070,3668196..3668406,3668462..3668739,3669058..3669365,3669476..3669579,3669945..3670195,3670333..3670453,3670503..3670690,3671562..3671661))
AA seq 649 aa
MVHLRIFIFLLAPLGSASFFNPDTNVSRVDVSHLSRALSYGANEKLVILHKLPGEYVLLG
GRNHVYNISISSMLEIARYEWTSSDEARTNCAAISQTPASCENFIRTYFELTNDTLILCG
THALQPTCAEFRKGNAKPQRLISAVGMSPIDADSTAPFIRSNENIITVNVAELSSSEPLL
VRRNVIKMWKGIENDVILRTPRGLSSFEQANFLSMHKVKKEVLFFFSESPMETEGCGLHK
VARVGRVCEDDPGGRLSYNKEWSSYEKARIECSIEETDTDTFYFNQFAGVAESPTSFYGA
FRSQLAGIGASAICKYSKKVISGSFASGYKESTPDTCSRANDIEELSRIRLKPLIKQKIS
ANPIYIFHGKDRFVHVLAQEDTRDLSNRAYDILYVATNLGNILKIVVPSTDKTGRHAVTL
KVLPTNSKIVDMSLYSKNNLEELIVITEQSVLKVPTATCHLASNCAECLAHGDPHCAWAD
GVDCIDIRTDQRKSASQDSGTCDVVSFENHKPVMIAPLKNKESAKIPVCLCETEKQKKPC
ATEVIQKEIVLTGGSEFWKYILVFAVGVLTGSIFHYCYFYFSRHIGDKASSSSRSSSSMT
RPITTSSSARLPIDAFTTSSIADEMFSSTLSSANRFNSVSMHSSIRTYC
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggtccatcttagaatatttatttttctactggcaccactgggctccgcgtcgtttttc
aatccggacaccaatgtgtctagggttgatgtttcccatttatcccgtgctctatcctac
ggagccaatgagaaactggtgattcttcacaaattgcccggggaatatgtacttcttggt
ggtagaaaccatgtctataacatctcgattagttcaatgctggaaattgcaagatatgaa
tggacatcaagcgatgaagccaggacgaattgtgccgcgataagtcaaactcccgcgtct
tgtgaaaactttattcgaacatattttgaactaacaaatgatacgctcattttatgtgga
acacatgcattacaaccaacatgtgcagagtttaggaaagggaatgcaaaaccgcagcgc
ctcatctcggcggtgggaatgtctccaatcgatgcggattctactgctccattcattcga
tccaatgaaaacattattacagtaaacgtggcggagctatcgtcatctgaaccattactt
gttcggcggaatgttatcaaaatgtggaagggcattgagaacgacgtaatattgcgtact
ccacgtggtttgagctctttcgagcaggcaaacttcttgtcaatgcataaagtgaaaaag
gaggtactcttcttcttctccgaatcaccaatggaaacagaaggctgcggtctgcataaa
gttgcgcgggtcggacgtgtttgtgaagatgatcccggtggcagactttcatataacaaa
gaatggagttcttatgagaaagcacgaatcgaatgttccattgaagaaactgatacggat
acattctactttaatcagtttgccggagtcgctgaatcaccgacctctttttatggagcc
tttcgttctcagctggcaggaatcggagcttctgcaatttgtaaatatagtaaaaaagtg
atatcgggcagttttgcgagtggatataaggagtcaacacccgacacttgctctagagct
aatgatattgaagagctgagcaggataagattgaaaccactgataaagcaaaaaatctct
gccaacccaatctacatattccacggaaaagatcgatttgtgcatgttcttgctcaggaa
gacactcgagacctcagcaatcgagcatatgacattttatacgtagcaacaaacctagga
aatattttgaaaattgttgtgccgtccactgacaaaactggaagacacgcggtgacattg
aaggtacttccaacgaattcaaagattgttgatatgagtctatattcaaagaataatcta
gaagaattgattgtgatcacagagcaaagtgtcctgaaagtcccaacagccacgtgtcac
ttagcttccaactgcgccgaatgcctagcgcacggagatccacattgtgcatgggctgat
ggtgtagattgtattgatattcggacagatcaacgaaaatctgcaagtcaagacagtgga
acgtgtgatgttgtcagcttcgagaatcataagccagtgatgattgcgcccctgaaaaat
aaagaatcagccaaaattccagtttgtctatgtgaaacagaaaaacagaaaaagccctgt
gccactgaagtcatccagaaagagatcgttcttacaggaggatcagaattttggaagtac
atattggtgttcgctgtcggtgttctaacaggttcaatcttccactactgttatttctat
ttcagcaggcatattggtgacaaggcatcttcatcatctcgttcgtcatcatcaatgact
cgaccaatcactacctcgtcttcagcacgcctcccaatcgacgctttcaccacgtcatca
attgcagacgaaatgttctcatcgactctttcatctgcaaatcgtttcaactcggtttca
atgcattcctctattcgtacctattgctga

DBGET integrated database retrieval system