KEGG   Caenorhabditis elegans (nematode): CELE_E02H1.8Help
Entry
CELE_E02H1.8      CDS       T00019                                 

Gene name
mrpl-53
Definition
(RefSeq) Mitochondrial Ribosomal Protein, Large
  KO
K17434  large subunit ribosomal protein L53
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_E02H1.8 (mrpl-53)
Ribosome [BR:cel03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CELE_E02H1.8 (mrpl-53)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MRP_L53 L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 3565796
NCBI-ProteinID: NP_001022058
WormBase: WBGene00008459
Ensembl: WBGene00008459
UniProt: Q7YX52
Position
II:join(9597625..9597717,9597765..9597933,9597981..9598108)
Genome map
AA seq 129 aa AA seqDB search
MSQLWSKIRYGVRWNPAERLALATRALNLQKVKSIDISLDPLHHDNLSIRTFWHSIMAPK
VRLTNPNVRVKTDIRNDRRAPFFVATLDDGQKLHFSTENMTAMDVIMNFNRLTGQPELGK
AGTRPRAKI
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactttggtcaaaaatcagatatggagtacgatggaatcctgcggagaggctg
gcacttgctacaagagcgctcaatttgcaaaaggtaaaatcaatcgatatctcattggat
ccacttcatcacgacaatctatcaattcgcaccttttggcactcgataatggctccaaaa
gtgcgcctaaccaacccaaacgttcgtgtcaaaactgatatccggaatgatcgacgagca
ccattttttgttgcgactcttgacgacggtcaaaaattgcacttttcaactgaaaatatg
actgcaatggatgtgattatgaatttcaatcgattgactggacaaccagaactcggaaaa
gctggaacccgcccgagagcgaagatttaa

DBGET integrated database retrieval system