KEGG   Caenorhabditis elegans (nematode): CELE_E03A3.4Help
Entry
CELE_E03A3.4      CDS       T00019                                 

Gene name
his-70
Definition
(RefSeq) Histone H3.3-like type 1
  KO
K11253  histone H3
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_E03A3.4 (his-70)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_E03A3.4 (his-70)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    CELE_E03A3.4 (his-70)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_E03A3.4 (his-70)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 184006
NCBI-ProteinID: NP_497812
WormBase: WBGene00001944
Ensembl: WBGene00001944
UniProt: Q27490
Position
III:complement(4059715..4060119)
Genome map
AA seq 134 aa AA seqDB search
MARTKHTARKSFGGKAPRKSLATKAARKVFPVDGQVKKRYRPSSNALKEIRKYQKSTELL
VRKLPFQRLVREVAQEIMPNVRFQSAAIQALHEAAEAYLIGLFEDTNLCAIHAKRVTIMP
KDMQLARRIRGERG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaaccaagcacactgctcgcaagtcgtttggaggaaaagctccgagaaagtca
ttggcgacgaaggctgctcgtaaggttttccccgtcgacggacaagtcaagaagcgctat
cggccaagttccaatgcactcaaggaaattcgaaaatatcaaaaatccacggagctgctg
gtccgcaagttgccattccaacgtctcgttcgtgaagtcgctcaagaaatcatgccgaac
gttcgattccaatctgctgccattcaggctcttcatgaagctgctgaagcttatctcatc
ggactcttcgaggataccaacttgtgtgccatccatgcaaagcgagtcaccatcatgccg
aaggacatgcagttggctagaagaattcgtggcgagcgtggataa

DBGET integrated database retrieval system