KEGG   Caenorhabditis elegans (nematode): CELE_E03G2.3Help
Entry
CELE_E03G2.3      CDS       T00019                                 

Gene name
mec-5
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 181678
NCBI-ProteinID: NP_741941
WormBase: WBGene00003169
Ensembl: WBGene00003169
UniProt: G5EFQ9
Position
X:join(15944012..15944137,15944192..15944309,15945703..15945800,15945844..15946167,15947491..15947617,15948274..15948356,15948704..15948811)
Genome map
AA seq 327 aa AA seqDB search
MRLLILLLLTISSIYCALDTAAVIAIQTEINKHSADIEMILDHVKNLNARVSDLGRPGPP
GTNGSPGFPGSKGEKGDRSEDGMSGRDGMQGIPGVKGDMGPLGPTGMKGDKGSMGFPGQK
GEGGNSGIPGLKGDTGIPGKVGEPGSTGQPGSKGEKGMEGLPGTNGLPGAPGWPGSKGED
GLPGRPGSPGFPGKKGDVGNGGVPGVPGMIGERGLPGAPGAQGMMGPIGPPGQLGLPGPK
GDLGSAGLPGSKGEMGKDGIPGLPGWIVNDKGYCILALGNCPPAFTQIGAYQAHVDNYRF
GDYSLVKSSGIGGNEEQFALKVHACCR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgactactaatactattactactgactatcagttccatatattgtgcccttgacaca
gcggctgtcatcgcaatccagacagaaatcaacaaacatagtgcagatattgaaatgatt
ttagaccacgtaaaaaatctgaatgcacgtgtaagtgatctcggtcgtcctgggccacct
ggaacaaatgggtcaccaggattcccagggtcaaaaggagagaaaggagatcggtcagag
gatggaatgagcggtagagatggaatgcaaggtatccccggagtgaaaggagatatggga
ccgcttggaccaactggaatgaaaggagataaaggatctatgggtttccctggacaaaaa
ggagagggtggaaactctggaattcctggactcaagggagacaccggtatacctggaaag
gttggcgaacctggatcaactgggcagcccggctcgaaaggagaaaagggaatggaagga
ctcccaggaaccaacggtctgcccggtgctcctggatggccaggcagtaagggtgaagat
ggacttccgggaagaccagggtcgccgggattccctggaaagaagggagacgttggaaat
ggaggagtcccaggagtgcctggtatgattggagaacgaggattgcccggagcaccggga
gcacagggaatgatgggaccaattggaccacccggacaacttggactcccaggaccgaag
ggtgatcttggatctgctggacttccaggaagcaaaggagaaatgggaaaggatggaatt
ccaggtcttccaggctggatcgtgaacgacaaaggctactgcatcttggcgctgggcaac
tgtcccccggctttcactcagattggagcttaccaggcgcatgttgacaattatcgcttc
ggcgactattcactggtcaagtcatccggcatcggaggaaacgaagaacaattcgcgttg
aaagttcatgcttgctgccgataa

DBGET integrated database retrieval system