KEGG   Caenorhabditis elegans (nematode): CELE_E04F6.3
Entry
CELE_E04F6.3      CDS       T00019                                 

Gene name
maoc-1
Definition
(RefSeq) MAO-C-like dehydratase domain
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel01040  Biosynthesis of unsaturated fatty acids
cel01100  Metabolic pathways
cel01212  Fatty acid metabolism
cel04146  Peroxisome
Module
cel_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CELE_E04F6.3 (maoc-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CELE_E04F6.3 (maoc-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CELE_E04F6.3 (maoc-1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     CELE_E04F6.3 (maoc-1)
    4.2.1.119  enoyl-CoA hydratase 2
     CELE_E04F6.3 (maoc-1)
SSDB
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N
Other DBs
NCBI-GeneID: 174181
NCBI-ProteinID: NP_495494
WormBase: WBGene00017123
Ensembl: WBGene00017123
UniProt: Q19058
Position
II:join(7196338..7196425,7196474..7196615,7196662..7197139,7197203..7197391)
AA seq 298 aa
MDKKTACAHVAEPCEFSYSTRDAIIYALGVGARAKEDLCYVYENHEDFKVLPSYIVAPGF
QAHTLMDWPGVEFDLQRVLHGEQYIEVYQPLSAEGKLKSEARVVDILDKGSGALILGNVT
TYDENGKKIAMQQFSTFQTGSGNFGGDRTSPHEIKAATVPDRAPDAVIEQKTTVDQAALY
RLGSGDMNPLHVDPEFAKMSGFKTPILHGLCSLGFATRHVIAAWAGNDSDKFKAIKVRFS
SPVLPGQTLVTETWKNGKRIIFQMKVKETGKIVISNAFIDLHEASELPTVPIDLASKL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggataagaaaactgcttgcgcacatgtggcagagccatgcgagttctcatattctacc
agagatgctattatttatgctcttggagttggtgctcgagcgaaagaagatttgtgctac
gtttatgagaaccatgaagactttaaagtgcttccatcgtacattgttgctccaggattt
caagctcacactttgatggattggccaggagttgaatttgatcttcagagagttcttcac
ggagaacaatatattgaagtctatcaaccactttcagcagaaggaaaattgaaatctgaa
gctagagtcgttgatattcttgacaaaggatccggtgctttgattcttggaaatgttacc
acttatgatgaaaatggaaagaagattgcaatgcaacaattcagtacttttcaaaccggt
tctggtaacttcggaggggatcgtacatcacctcatgaaataaaagctgccactgtccca
gatagagctccagatgcagttattgaacaaaagacaacagttgatcaagctgctctttat
cgtttgggatcaggagatatgaatcctcttcacgttgatccagagtttgctaagatgtct
ggattcaaaactccaattcttcatggattgtgcagtctgggatttgcgacacgccatgtt
atcgctgcttgggctggaaatgattctgacaaattcaaagcaatcaaggttcgattctca
tcgccagtgcttccaggacaaacattggttactgaaacctggaagaatggaaaacgaatt
attttccaaatgaaggttaaggaaactggaaaaattgtaatttccaacgcctttattgac
ttgcacgaggcttccgaacttccaacagttccaattgatcttgcatcaaaattgtaa

DBGET integrated database retrieval system