KEGG   Caenorhabditis elegans (nematode): CELE_F02E8.1Help
Entry
CELE_F02E8.1      CDS       T00019                                 

Gene name
asb-2
Definition
(RefSeq) ATP Synthase B homolog
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00190  Oxidative phosphorylation
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CELE_F02E8.1 (asb-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mt_ATP-synt_B
Motif
Other DBs
NCBI-GeneID: 180718
NCBI-ProteinID: NP_508770
WormBase: WBGene00000207
Ensembl: WBGene00000207
UniProt: Q19126
Position
X:join(4469775..4469859,4469921..4470111,4470158..4470392,4470704..4471020,4471133..4471222)
Genome map
AA seq 305 aa AA seqDB search
MSLSRCLPLGQNARVIIIPARLAHAASTQAAAATDDAPNFFQKLAHRFQGVPLKGEAHAP
KSMFEDCNKEWSAPEPLPAIPKDFKEHPDRDLVNYPYPARPMYPPKSRLLMMPDSWFTPF
QKVTGVSGPYLFFGGLFAFLVNKELWVFEEQGHMTVGWILFYLLVTRTAGYKIDQGLYNG
YQERVNFFKGLIQEDLKEAVEFKKTSAKQTESLNSIKESYPTALKESMALQLEATYRKNV
QSVATELKRRIDYLKETEESKARVEREQLLKLINSEVDKEFSDRSFKDKYLQNAIQQLKG
LNVQL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgagccgctgccttccactgggccaaaacgcccgtgtcatcatcatcccagcc
cgattggcccacgccgcttcgacccaggctgccgccgccaccgacgatgccccaaacttc
ttccaaaagttggctcaccgcttccaaggagtcccactcaagggagaggctcacgctcca
aagtcaatgttcgaggactgcaacaaggaatggtctgctccagaaccactcccagcaatt
ccaaaggacttcaaggagcatccagatcgtgacttggtcaactacccatacccagccaga
ccaatgtatccaccaaagtctcgtcttctcatgatgccagactcgtggttcaccccattc
cagaaagttaccggagtctccggaccatacctcttcttcggaggactcttcgccttcctt
gtcaacaaggagttgtgggtgtttgaagagcaagggcacatgactgtcggatggattctg
ttctatcttttggtcaccagaactgctggatacaagatcgaccaaggattgtacaatgga
taccaagagcgcgtcaacttcttcaagggactcatccaagaagatcttaaggaggctgtt
gagttcaagaaaacatctgccaagcagaccgagtctttgaactccatcaaggaatcctac
ccaacagcactcaaggagagcatggcccttcaacttgaggccacatacagaaagaacgtc
caatccgtggccaccgaattgaagcgccgtatcgactacctcaaggagaccgaggagagc
aaggctcgcgtcgagcgggagcagctcctcaagcttatcaacagcgaagtggacaaagaa
ttcagcgaccgatcgttcaaggacaagtatctgcaaaacgccattcaacagcttaaggga
ttgaatgtgcaactttaa

DBGET integrated database retrieval system