KEGG   Caenorhabditis elegans (nematode): CELE_F02E8.5Help
Entry
CELE_F02E8.5      CDS       T00019                                 

Gene name
atg-16.1
Definition
(RefSeq) Autophagic-related protein 16.1
  KO
K17890  autophagy-related protein 16-1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04136  Autophagy - other
cel04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_F02E8.5 (atg-16.1)
   04136 Autophagy - other
    CELE_F02E8.5 (atg-16.1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F02E8.5 (atg-16.1)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_F02E8.5 (atg-16.1)
Membrane trafficking [BR:cel04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    CELE_F02E8.5 (atg-16.1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    CELE_F02E8.5 (atg-16.1)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    CELE_F02E8.5 (atg-16.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 ATG16 WD40_like Glyco_H_20C_C DUF3450
Motif
Other DBs
NCBI-GeneID: 180717
NCBI-ProteinID: NP_508768
WormBase: WBGene00017178
Ensembl: WBGene00017178
UniProt: Q19124
Position
X:complement(join(4459869..4459956,4460002..4460151,4460199..4460466,4460528..4460645,4460944..4461070,4461123..4461244,4461293..4461383,4461626..4461697,4461741..4461871,4461920..4462040,4462100..4462307,4462369..4462609))
Genome map
AA seq 578 aa AA seqDB search
MQTRSIDNVVNWSRCVHPSCVAWVIFIHFCFAKNCSILYFVLFQFTFFAELMADSYRKLI
IERLEDVKQRNKQTATLYNNYSKLAEQLEKKHKYGTSSSNSSQLETGELARVKEEMAELY
RSKCQNDQRLIDANHRIADFEKKSSAIIAEKIALEATAKSICAKYAKTEVELQRLKVDND
QLNDERIASNTTVTMLTKQIQDIENDRIHFLNKIRELNEQRVDFLNAEVALEEKRRNSRI
QDMITSAVQDITDKDTKLEEMLRAMPDTNSNGDLLLGDSVPSRAEFVLECEEGEVNDVHW
LDGETFATGGSDRNIKIWKVDGHGGYTRIGTLAGSNAAFTRIDYERDRKHFIASSNDKNV
RIWNLDNSRLLSTLSGHSDQVTCVKFYQSHSAVSGSADRVIKIWDIQNQRCSRSLFPASK
VLDVATNMGASPSLFASGHFDKKLRFYDGRSTDPVRTVDMGGRITSLDVTMSGCELLVST
RDDTISLIDLRTFQTVHCYSAENYRTSSDLSRVVLSSGNEYVAAGSSNGSIFVWNRNSTK
LEKQLCSNSENAIFSLSWNPTGYGLLSSSKQKFVTLWK
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgcgctctattgacaacgtagtaaactggtcacgctgtgttcacccgagttgt
gttgcttgggttatttttatccacttttgtttcgcaaaaaattgctcaatactttatttt
gttttatttcaatttactttttttgcagagttgatggcagactcgtatagaaaattaatt
attgaaaggttagaagatgtcaaacagagaaataagcagacagcaacattatataacaat
tattcaaaactagcagaacaactagaaaagaagcacaagtatggtacctctagttcaaat
agtagtcagctagaaactggagaattggctcgcgtgaaggaggaaatggccgagttgtat
cgatccaagtgccaaaatgaccagaggctcattgatgcaaatcatagaattgcagacttt
gagaaaaagtctagtgcaattattgctgaaaaaattgcactggaagcaacagcaaaatca
atatgtgcaaaatatgcaaaaacagaagttgaacttcagaggttaaaagtcgacaacgat
caactgaatgatgagcggattgcttctaataccacagtaacaatgctgacaaaacaaata
caagacattgagaacgatcgaatccattttctgaacaaaattcgagagctcaacgagcaa
agagtcgattttctgaacgcagaagttgctttagaagaaaaacgacgaaactctcgtatt
caagatatgatcactagtgctgttcaagatatcaccgacaaggacacaaaactagaagaa
atgttgcgtgctatgcctgataccaattctaatggagatttacttcttggcgacagtgtg
ccatcccgcgcagagtttgtcttggagtgtgaggaaggagaagtaaacgatgttcattgg
ctcgacggagaaacgtttgcgactggaggatctgaccggaatatcaagatttggaaagtc
gatggacacgggggatacactagaattggaacactcgctggcagtaatgctgcattcact
aggatagactatgaaagagatcggaagcattttattgcatcttctaatgacaagaatgtt
cggatttggaatttggataactctcggcttttgagtactctctctgggcattctgatcaa
gtaacatgcgtcaagttttatcaatcacattcggcggtttctggcagcgcagaccgggtt
atcaaaatttgggatattcaaaatcaaagatgcagccgctctctattccctgcgtctaag
gttctcgacgttgcaaccaatatgggtgcaagcccatcactattcgcatcaggacatttt
gacaaaaaactaagattttacgatggaaggtcaacggatccagttagaactgttgacatg
ggaggtagaattacttctttggatgttacaatgagtggatgtgaacttctcgtttcgact
cgtgatgacactatctccctgattgatctacgaacgttccagacggttcactgttacagc
gcggaaaactaccgtactagttccgacctttcaagagttgttttatcatccggaaatgaa
tacgtcgctgcaggaagttcgaatggaagcatcttcgtctggaatagaaatagtactaag
ctagaaaaacagctttgcagtaactcggaaaatgccatattctcactttcatggaaccca
acaggatacggactgttgtcatcgagcaagcaaaaatttgtcacattatggaagtaa

DBGET integrated database retrieval system