KEGG   Caenorhabditis elegans (nematode): CELE_F07A11.2
Entry
CELE_F07A11.2     CDS       T00019                                 

Gene name
gfat-1
Definition
(RefSeq) Glutamine-Fructose 6-phosphate AminoTransferase homolog
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00250  Alanine, aspartate and glutamate metabolism
cel00520  Amino sugar and nucleotide sugar metabolism
cel01100  Metabolic pathways
Module
cel_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_F07A11.2 (gfat-1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_F07A11.2 (gfat-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_F07A11.2 (gfat-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     CELE_F07A11.2 (gfat-1)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C44
   CELE_F07A11.2 (gfat-1)
SSDB
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 SIS_2 GATase_2
Other DBs
NCBI-GeneID: 174778
NCBI-ProteinID: NP_496479
WormBase: WBGene00008546
Ensembl: WBGene00008546
UniProt: Q95QM8
Position
II:complement(join(11592552..11592596,11592650..11592853,11592899..11593741,11593790..11594070,11594324..11594380,11594432..11594464,11594707..11595382))
AA seq 712 aa
MCGIFAYLNFLTPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNEIESPHSSVALLRK
AGKVSVLSDFIKESSSDLDMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDKNEFLVV
HNGIITNYREIKEYLEKKGHKFESETDTEVIAKLAQHIHDRYPDFSFRQLVETVIQQLEG
AFALAFKSSRFPGQLVASRRGSPLLVGIKSNSRLQTNHFPVSFSKGRRFMSNHATHLRDE
TSFVETPNNILDLSIAVRSSNGSAKMEISDSTTAVRPFDSDDWEVEYFVASDAAAIIEHT
KQVLFLEDDDVAFVEDGALTIHRISRHADNGEQKREVKLLEMELQEIMKGSFKTYMQKEI
FEQPDSVVNTMRGRVLPSGQVVLGGIKEYLPDIKRCRRLIMVACGTSYHSAIACRQILEE
LSELPVVVELASDFLDRETPIFRDDVCLFISQSGETADTLLALRYCKPRGALTIGVTNTV
GSSICRESHCGIHINAGPEIGVASTKAYTSQILSLLMFALTLSDDRISMAKRREEIIDAL
NDLPELIREVLQLDEKVLDIAKQIYKEKSLLIMGRGLNFATCLEGALKIKELSYMHCEGI
MSGELKHGPLAMVDEFLSICMVVCNDRVYKKSLNALQQVVARKGAPIIIADCTVPEGDLA
GMKHILRVPKTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgtgcggaattttcgcctacctcaacttcctgacaccgaaaaaacgatcggaaatcgtg
gatattttagtccaaggattgcaaagaatggaatacagaggctacgactctgcaggaatc
gccatcgacggatccaatgagatcgaatcaccacattcttcggtagcacttctgcgaaaa
gctggaaaggtgtccgtgctcagcgatttcatcaaggagagctccagcgatcttgacatg
gatatggagtacaacattcactgcggaattgcacacactcgctgggcaactcacggatct
ccacgtgatgtcaattcccatccacatcgcagtaacgacaagaatgagttcctcgttgtt
cacaatggaatcattacgaattatcgtgaaatcaaggagtatctcgagaagaagggacac
aagtttgagtcggagaccgacacggaagtcatcgcgaagcttgcgcaacacattcacgat
cgttacccggatttctcgttccggcaacttgtggagactgtcattcaacagttggaagga
gctttcgctcttgcattcaagtcatctcgattcccaggacaactcgttgcttcaagacgt
ggatccccattgttggtcggtatcaagagcaactccagactccagacaaatcacttccca
gtctctttctctaaaggacgtcggttcatgtccaaccacgctactcatttgcgagatgag
acatcgttcgtcgagactccaaacaacattctggacctgtcaatcgccgttcgttcgtct
aatggatctgctaagatggagatctccgacagcacgacggccgtccgtccattcgactcc
gacgattgggaggttgaatacttcgtcgcttcggatgctgctgccatcattgagcatacc
aagcaagtccttttcctagaggatgatgacgttgcattcgtcgaggatggagctctgact
atccatcgcatctctcgacacgctgacaatggagagcaaaagagagaagtaaagcttctc
gagatggagcttcaggagatcatgaagggatctttcaaaacgtacatgcagaaggagatt
ttcgagcaaccggattcggtagtcaacacaatgcgtggacgtgttcttccatcgggacaa
gtcgttctaggaggaatcaaagagtaccttcctgatatcaagcgttgccgccgtctgatt
atggtagcctgtggaacatcctatcactctgccatcgcatgccgtcagatccttgaagaa
ctttctgagctgccagtcgtcgtcgaacttgcttctgacttcttggatcgtgaaacccca
atcttccgtgatgatgtatgtctcttcatttctcaaagtggagagactgccgatacgttg
ttggctctcagatactgcaagccacgtggagctctcacaattggagtcaccaacactgtc
ggatcatccatttgccgtgaatctcattgcggaattcacatcaacgccggaccggaaatt
ggagtcgcctctaccaaggcctacacttctcagatcctatccttgcttatgtttgctctc
accctctccgatgaccgaatctccatggctaagagacgtgaagagatcattgacgctctc
aacgatcttccagaacttatccgcgaagttctccaactcgacgagaaagttcttgatatc
gccaaacaaatctacaaggagaaatcacttctcatcatgggaagaggattgaactttgcc
acatgcctcgaaggagctctcaagatcaaggagctttcctacatgcattgcgaaggaatc
atgtctggagaactgaagcacggtccacttgccatggtcgatgagttcctcagcatctgc
atggttgtttgtaacgatcgcgtatacaagaaatcgttgaatgcacttcaacaagtcgtt
gctcgcaaaggagctccaatcatcattgccgactgcaccgttccagaaggcgatctcgct
ggaatgaagcatattcttcgtgtaccaaaaactgttgattgtgtccaaaacattctcaca
gtcattccactccagctactctcatatcacattgctgagctcaatggagctaatgtcgac
cgaccccgcaacttggccaagtcagttaccgtcgagtaa

DBGET integrated database retrieval system