KEGG   Caenorhabditis elegans (nematode): CELE_F07C3.4Help
Entry
CELE_F07C3.4      CDS       T00019                                 

Gene name
glo-4
Definition
(RefSeq) X-linked retinitis pigmentosa GTPase regulator homolog
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RCC1 RCC1_2
Motif
Other DBs
NCBI-GeneID: 179306
NCBI-ProteinID: NP_505392
WormBase: WBGene00017195
Ensembl: WBGene00017195
UniProt: Q5DX34
Position
V:complement(join(9234986..9235141,9235195..9235973,9236021..9236804,9236853..9237017,9237069..9237151,9237199..9237550,9237601..9237802,9237902..9238035,9238153..9238218,9238266..9238476,9240124..9240278,9240328..9240552,9241008..9241226,9241529..9241678,9241973..9242046,9242661..9242906,9243005..9243164))
Genome map
AA seq 1386 aa AA seqDB search
MFFKRSTNSRKTSANSSSDTSTSSESLLLPLLNNTKAGARSQKGSVHRQSGKKARRKMME
NPYVCSLELDELSADDSIIDYSVFSDDSFLLILLLTSKGDVQAYLETSRDTKPRKNVVNI
KTACSLNVSPVTVCIGSQAAFAIFGLADGNLLVTPIRLLIDVTWGGSSWATTTVIDLSLP
TVDPCLATPTCTKCFVSNFPPCTMAVVANKAGNILLVDLHLRKCVSELKAPQSLHQIDIL
LDENSIELLVTGFTGAQWIIPIERSGKGFREVLTTCVPSDLTVLEPATMQFFAADSCGVV
ALDTTESIVEVYNTFHSLAHSSKRTFKVPPETWMVHAGDNMLFTVSNDNEIRSALHFGFM
SSRLEYTLVRTSTNWRPLGIVAMPSRPHKLAGIFVVNERGLVRVEQSTALNLTKIASEFF
FRLSPLQLNSKSVAQVANACRIDTAEFQSALIPNLLSTRKNRQLTNKELSQIYSIAKAIN
LSMSDLLKAFENESIGEQLLPEVLNTIQTNPAKHDNLMQRVVEMFVKRSLSAEGNMDKIR
EYDAELSNFLARHEHLHKGSVDCAKAGMWKCTQTLVRRDVHETKSIDTSTEVLLYIIKNR
LQIWNEANSTDRLQIMSLVCHLDWSKLADADGARVCAILSAWQRDISLPSYHEMCLRIAI
TNSDRFPRPCQILSLVSSIHILSEKKISNHANLPNFLPLAGGNNCGATITEDDRLMIWGN
FTNAQQRMEMPQMNAKSKRSDSVTNGAPTLPPPAPKPEQHLPRVLEYPGGRPRAIACGAE
HILVLSSSGQLSAWGGNRFGQCGVGHSFRIANLHQVDGDWPAIEKIACGQFHSAFICSDG
SLWTFGWGVWGQLGHGGRNNSNQLVPTRVNGLICKVTQIACGRAHTVVLTDTGRVLVCGS
GSYGQMGVDDDIKKVFAFTPLPLGPLRVRDIATHYYHSICITEDNRVFEWGRNPQELKMR
MFVMKKIRSAQLKNTEDPSSPSPSTNGSTPRVNLNLPAEIPREDLGLREVKHFLDGNIVS
VACGLSHSALITSEGTLYTWGKGLDYQLGHGNKNERMEPHQVFEPNGAKWVNVSLGNNHT
IASTDDGSVFAWGKNDFGQCGVLTKKNGNSADVTKKFFFQARDGRRFMPNVDESQFVQKP
GLIPDVRVRNLNEDGNEGVDKEEIVDRLKASDVNVVQAVSKHLYSPIEGKCNGSIIEDEP
RNGKIQKQNKYDGEDGPLCTTTALVHLIAGDVKRAIRMIEWLKTDSSTCEKSLMVLSSLV
WEVMANHEDVQSREALSAAFRHVPMSDSMRKGKQIAQLWPAVWNDERVQSSLSIDEKIAM
LDGFTSASKPVSCPTIPSSSLEVSSKIRVYAQCAHAEPAAVGSPPECSTCLDEWTEKVRH
TLGTQL
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcaaacgaagtacaaattctcgtaaaacatcggcaaattcaagttctgatacg
tcaacttcttcagaatcattattgcttccacttctgaacaataccaaagctggagcgcgt
tcacaaaaaggaagtgtccaccgacaaagtggcaaaaaagcccgccgaaagatgatggaa
aatccttacgtgtgcagtttggaactcgacgagctctctgccgatgattcaattattgac
tattcggtgttcagtgatgattcgtttcttctaatcttgctgcttacgtcaaaaggagac
gttcaagcttatttggagacaagtcgagacacaaagccaagaaaaaacgttgtaaatatc
aaaacggcatgctccctcaatgttagcccggttactgtatgcattggaagtcaagcagca
ttcgccatctttggacttgctgatggtaatcttctcgttactccaatcaggcttcttatc
gacgtgacgtggggtggttcctcgtgggcgacaacgactgtaattgatttgagtcttcca
acagtggatccttgcctggccacacccacttgcactaaatgcttcgtttccaattttcca
ccgtgcactatggctgtggttgcaaataaagctgggaacattcttctcgtcgatcttcac
ctcagaaaatgtgtgtccgagttgaaagcaccgcaaagtttgcaccagattgacattctt
cttgatgaaaactctatcgagttgcttgtcacgggatttactggtgcacaatggataatt
ccaattgaaagaagtggaaagggatttcgagaagttttgacaacatgcgtaccatcagat
cttactgtgctcgagccggcaacaatgcagttctttgcggcggattcatgtggtgtcgtt
gcacttgacacaaccgaatcaattgtggaagtctacaatacgtttcattcattggcacat
tcttcgaaacgaacattcaaagtacctccagagacttggatggtgcatgctggtgataat
atgttgttcacagtttcgaatgataatgaaatcagaagcgctttacatttcggattcatg
tccagtcgtctggagtatactcttgtacgcacgtccactaactggcgtcctctcggaatt
gtagcaatgccatctcgaccacacaaattggctggaatattcgtagtcaatgagcgaggt
ttggttcgtgtggaacagtcgactgctttaaacctcacgaagattgcttctgaatttttc
ttccgcctctctccactgcagctcaattcgaaatcagtggcccaagtcgcaaatgcatgt
agaatcgatacagccgaatttcaatccgcattgattccaaatctactgagtacgcggaag
aataggcaattgacgaataaagaattgtcacaaatttactcgattgctaaagctataaat
ttatccatgtccgacttgctcaaggcgttcgagaatgaatcaattggtgaacaactgctt
cccgaggtgctcaacacgattcaaactaatcctgcaaaacatgataatctaatgcaaaga
gttgtcgaaatgtttgtgaaaagatcattatcggctgaaggaaatatggataagattcgc
gagtatgatgcagaattatcaaacttccttgctcgtcacgagcatcttcacaagggttct
gttgattgtgctaaagcgggaatgtggaagtgtactcaaactcttgttcggcgagatgtt
catgaaacgaaatcaattgatacatcaactgaagttcttctttacatcatcaaaaatcgc
ctccaaatctggaatgaagccaactcaacagatcgattacagataatgtcacttgtttgc
catttggattggtctaagttagcagatgctgatggtgctcgagtttgtgctattttatct
gcttggcaaagagatattagccttccatcttaccatgaaatgtgcctccgtatcgctata
acaaattcagatcgttttccgcgaccgtgtcagatactttcactcgtctcatcaattcat
attctatcggagaagaaaatatcgaatcatgctaaccttccaaattttcttcctcttgct
ggaggaaataattgtggagccacaataactgaagatgaccgtctcatgatctggggaaat
ttcacgaatgcacagcaacgaatggaaatgcctcaaatgaacgccaaatcgaaaagatca
gactcagtcacaaatggagcaccaacattacctccaccggcaccaaaacctgaacaacac
cttccccgcgttctcgaatatcccggtgggcggcctagagcgatagcttgtggagccgag
cacattcttgttctgtcttcttctggacaattgtcggcatggggtggaaatagatttgga
cagtgtggtgttggacactcttttagaattgctaatttacaccaagttgatggagattgg
cctgcaatcgagaaaatcgcatgtggccaattccactcggcttttatatgttctgacgga
tcactgtggacttttggatggggagtatggggtcaacttggacacggaggtcgaaataac
tccaatcaacttgttcctactagagtgaatggattgatatgcaaagtgactcaaattgca
tgcggaagagctcatactgttgttctgacggatactggaagagttcttgtttgtggatca
ggaagttatggacaaatgggagttgatgatgacattaagaaagtttttgcattcactcca
ctgcctcttggacctcttcgtgtgagagacattgcaacacactattatcattccatttgt
attacggaagacaatagagtttttgaatggggtcgaaatcctcaagagctcaagatgcga
atgttcgtaatgaagaaaattcggagtgctcaacttaagaatacagaggatcctagctca
ccatcaccgtctaccaatggtagcactcctcgcgtaaatctgaatttgccagctgaaatt
cctcgagaagatcttggtcttcgggaagtcaaacatttccttgatggaaatattgtcagt
gttgcatgcggtttgtcacattccgctttgatcacatcagaaggaacgttatacacttgg
ggtaaaggtcttgactatcaacttggtcatggtaacaaaaatgaacgcatggagccccat
caagttttcgaaccaaatggagccaaatgggttaatgtctctcttggcaacaatcacact
atcgcctccacggatgatggttcagtttttgcgtggggaaagaatgactttggacagtgc
ggagtactcactaagaaaaatggaaactctgcggatgtcacaaaaaagtttttctttcaa
gccagagatggtcgtagattcatgccaaatgtcgacgaaagccagtttgttcagaaaccc
ggattgattcctgacgttcgagttagaaatttaaacgaggacggaaacgaaggtgttgat
aaagaagaaatagtggaccgcctaaaagcttccgatgttaatgtggtacaggcggtttcc
aagcatctgtacagcccgatcgaaggaaaatgtaatggaagcatcatagaagacgaacca
agaaacgggaaaattcagaaacaaaataagtacgatggagaagatggaccgctttgcaca
acaacagctcttgttcatttaattgctggtgatgtcaaaagagcgattcgaatgattgaa
tggctgaagacggatagttcgacatgcgagaaatcactgatggttctttcatcacttgta
tgggaagttatggcaaatcatgaagatgtacaatcacgtgaagccttatctgctgccttt
cgtcatgttcctatgtctgattccatgcgcaaaggaaaacaaattgctcaattgtggccg
gctgtttggaatgacgaacgtgtacaaagctctttgagcattgacgaaaaaatcgctatg
cttgacggatttacgagtgcttcaaaaccagttagctgtcctacgatcccatcttcttca
cttgaagtttcttccaaaattcgtgtctatgctcaatgtgctcatgctgaacctgcagcc
gttggttctccaccagaatgctctacttgtcttgacgaatggactgaaaaagttcgccat
actctaggaactcagttgtaa

DBGET integrated database retrieval system