KEGG   Caenorhabditis elegans (nematode): CELE_F08C6.3
Entry
CELE_F08C6.3      CDS       T00019                                 

Gene name
vps-52
Definition
(RefSeq) Vacuolar protein sorting-associated protein 52 homolog
  KO
K20298  vacuolar protein sorting-associated protein 52
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F08C6.3 (vps-52)
Membrane trafficking [BR:cel04131]
 Protein recycling
  Others
   EARP complex
    CELE_F08C6.3 (vps-52)
 Endosome - Golgi transport
  Tethering complex
   GARP complex
    CELE_F08C6.3 (vps-52)
SSDB
Motif
Pfam: Vps52 Sec3_C
Other DBs
NCBI-GeneID: 181018
NCBI-ProteinID: NP_509282
WormBase: WBGene00007059
Ensembl: WBGene00007059
UniProt: G5EFV8
Position
X:join(7565331..7565487,7565530..7565648,7565711..7565806,7565849..7566079,7566134..7566367,7566418..7566624,7566675..7566800,7566910..7567191,7567240..7567630,7567678..7567796,7567849..7567995)
AA seq 702 aa
MPRTRVNLQKSEANDRSFTISSLEFCLSQLRKADPNLVKKAIASGDGLTESKNDVSTRLS
EAHRYSVQQCLDNSEQLAQLHNQLVHCDNVFERLQATLYSFQDNLGSIGQDMKNLQLQSH
HIHQELENRQKVRVELSQFVDDIAVSQTMMKTINDTDANDRGFLEALHELHHKITLILQR
GNGDAVAVNDTMPILEGLKLKAVVKVREWLLQKMFQFRKPLSNYQVFQHQLLKCRFFYEF
LLHHDLISAKELQDEYIDTISKMFFTYFKAYATRLFKLAMKDVATKEDALGSIDFAKPAG
LGAIFSSKQHVVRNKATVFSIGQRHQILSDDFLGALIVPHAATQNHQSYQFEALFRSIQL
AFVDHYSHEYLFITDFFLVSNDEAIELHNKAMARAMSVVLKSCEEQIALSWDAISLHLCI
CLCDKFTEVLAEREVPEVSDYWNTVTSFLWTRLNLVMSQHYESVKSVDLKKLMHSGSLDA
RPHFIVRRYAELTSAHLMIAKASGKEMGAKMEAVLENSEDSIEQLLTRMSAMQQTQKNKH
VFLINNYDLILSIIDNEESKHTKIYAIVHELEQKSIDDFVEEMLEPHIGYMIKFVNECES
LIVQGHTQLLVRYNDKVGTVVANFNAKWRPAVDSINSECIQLFTNFSLGTTILQTIFTKY
VQYINRFTKILSHDVFAKNPVCSQLVNVHQVMLEIKRFKPAY
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgcctcgaacacgtgtcaacttgcaaaaatccgaggcaaatgaccgtagtttcacaata
tcgtcgctagaattttgtttatcgcaattgcgaaaagcagatccgaatttggtgaaaaaa
gcaattgcttctggtgacggactaaccgagtcgaaaaacgacgtcagcacgcggctatcg
gaggcacatcgttattctgttcaacagtgtcttgataactctgagcagttggctcaactc
cataatcaacttgtgcattgtgataatgtttttgaacgcttgcaagcaacattgtacagt
tttcaagacaatctaggatcaattgggcaggatatgaaaaatttgcagctacagtcgcat
catattcatcaagaactggaaaaccggcaaaaagttagagtcgagctgagccaatttgta
gacgatattgctgtttctcaaacgatgatgaaaactatcaacgacactgatgcaaatgac
aggggttttttggaagcgctccacgagttacaccacaaaataaccttaattttgcaaagg
ggaaatggagatgcggtagcggtaaacgacactatgccgattttggaaggactaaagctt
aaggcggttgtaaaagtgagggaatggttgcttcagaaaatgttccaattccgtaaacct
ctgtccaactaccaagtttttcaacaccagcttctcaaatgccgatttttctacgaattc
ctgttgcaccatgacttgatctctgccaaggaacttcaagacgagtacattgacaccatc
agcaagatgttcttcacgtatttcaaagcatacgccacacgcctgttcaaacttgcgatg
aaagacgtggccaccaaagaagacgctttgggaagtattgattttgcaaaacccgctgga
ttaggcgcaattttctcgtcgaaacaacacgttgttcggaataaggcaaccgttttttcg
attgggcaacgacatcaaattctctctgacgactttttaggagccttgattgttccccac
gcagctacgcagaaccatcaatcgtatcaatttgaagcactatttcgttctattcaactg
gcatttgtcgatcactacagccatgagtacctctttattaccgactttttccttgtcagc
aatgatgaagccattgaactgcataacaaggctatggctcgagcaatgtcagttgtgctc
aaaagctgcgaggagcaaatcgcccttagttgggacgccatcagtcttcatctgtgcatt
tgtctatgtgacaagtttaccgaagtgctcgccgagagagaggtaccagaagttagcgat
tattggaatactgtcacaagcttcctttggacccgcctcaatttggtcatgtctcaacac
tacgaaagtgtcaaatctgttgatttgaagaagttgatgcatagcggttcacttgatgca
agaccgcatttcatagtccgacggtacgccgaactgacaagtgcacatttgatgatagca
aaagcaagtggaaaggaaatgggtgcaaagatggaagctgtcttggagaacagtgaagac
tctattgaacaactattgactcgaatgtcagctatgcagcaaactcagaaaaataagcac
gtctttctgattaacaattacgatcttattctttcgattatcgataacgaggaaagcaag
catacaaagatttatgcaattgtccatgagcttgaacaaaaaagtattgatgattttgtt
gaagagatgctagagccacatattgggtacatgattaaatttgtcaacgagtgtgaatct
ctgattgttcaaggtcatacacaactcttagttcgatataatgacaaagttggaacggtg
gtagcaaacttcaatgcaaagtggagacctgcagtggacagtattaattcagaatgcata
caacttttcactaacttcagcctgggaaccaccattttacagacaatcttcacaaagtac
gttcagtatatcaatagattcacaaagattctgtcccatgacgtatttgctaaaaatccc
gtgtgttcccagttagtcaacgttcatcaagtgatgctcgaaatcaaacggttcaaacca
gcatattaa

DBGET integrated database retrieval system