KEGG   Caenorhabditis elegans (nematode): CELE_F08F1.1
Entry
CELE_F08F1.1      CDS       T00019                                 

Symbol
kin-9
Name
(RefSeq) Protein kinase domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SKG6 DUF347 FixS PAP_PilO
Other DBs
NCBI-GeneID: 181098
NCBI-ProteinID: NP_001257058
WormBase: WBGene00002195
Ensembl: WBGene00002195
UniProt: F3NWW5
Position
X:join(8432694..8432807,8433013..8433153,8433291..8433476,8434300..8434389,8434910..8435157,8435636..8435858,8435909..8436064,8436112..8436186,8436232..8436440,8436489..8436626,8437042..8437219)
AA seq 585 aa
MTHQCLTYLASSAALVSTLAFPTPAVDDSHEDWSAYKSRKYSTWTPSPQPSTMNAGTQTD
FRTARNENDNQNHNLSPSDIRYLETITNLSQQALNNVKSTIDTINEVEPPITSPPRSQYQ
APWNNQPYQQGSWASQYAPYPTLPPEHLVFHPHKPPHHQDDSLEKNPPPPPHKPRHLPTT
PLYYDPYYGGDKHSSEGGVNAVALGLGIGIPLGIIAFGLALFIFFWCRKRRRQNKNQFPL
PFPKKVNDYETQLDSPAYSIHDPWLLDRNNLEINYSKKLGSGAFCNVFKGKINGEAPVSQ
IHPGQRTQLLRDCPVAVKMLPSFADDAARSDFMQEINFMKSLAYHPHLVSMLGFVADRKS
PYLLVEFCEHGDLLHMIRNRRQEIINGPTENPDGLKIKDLLMFSWQISNGLEYLNNIGCI
HRDIAARNVLVDSANTCKIGDFGLCRLTDSLLYTARGGRLPLKWMAPESLATYEYSYKSD
VWSYGVLLWELFSLGEVPYGEVQTTELLQTHRSGKRLLKPEWCPEEIYDVMRLCWQELPD
DRPAFQQTCAVLAQMLENATENYGYLIPKHFNNQTRDPSEQCDNV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgacacatcaatgtttaacatatctcgcctcctcagccgctcttgtatccacattggct
tttccgacgccagccgttgacgactctcacgaagattggtcggcctataaatcaagaaaa
tattcaacgtggactccatctccacaaccgtccacaatgaatgcaggaactcagactgat
ttccgaactgcaagaaatgaaaacgataaccaaaatcataatctgagtccttcagacatt
aggtacttggaaacgataacaaatttatcgcagcaagcattgaataacgtgaagagtacc
attgacacaataaatgaagttgaaccaccgatcacgtcaccgccaagatctcaatatcaa
gcaccatggaacaaccagccttatcaacagggttcctgggcatcacaatatgcaccatat
ccgacactaccgcctgaacatcttgtcttccatccccacaaaccaccacatcatcaagac
gattcccttgagaagaatcctcctccaccacctcacaaaccacgtcatttgccaacaaca
ccattatattacgatccatactatggaggggacaaacattccagtgaaggaggcgtaaat
gcagttgcattgggtctgggcattggtattccactcggtataattgcgtttggtctcgca
cttttcatatttttctggtgtcggaagagaaggaggcagaataagaatcagtttccgctt
ccgtttccaaaaaaggttaatgattatgaaacccagttggacagcccggcatattcaata
cacgacccttggcttctggatagaaataatctagaaattaactactcgaaaaaacttgga
agtggcgcattttgtaatgtcttcaaaggaaaaatcaacggagaagccccagtttctcag
atacatcccggacagcgaacacagctactccgggattgccctgttgctgtgaaaatgctt
ccaagttttgcagacgatgcagctaggtctgatttcatgcaagaaataaacttcatgaaa
tcactcgcctaccatcctcatcttgtgtccatgttgggatttgtagctgatcgaaaatct
ccgtacttgctggtggagttctgtgaacacggtgatcttttgcacatgatacgtaataga
aggcaggaaattataaatggtcctactgaaaatccagacggcttgaaaatcaaggacttg
ttgatgttttcatggcagattagcaatggattggagtatctcaataacattggatgtatc
catcgggacattgctgcccgtaacgtcttagtagactcagcaaatacgtgcaaaattgga
gattttggactgtgtagattaaccgattcacttttgtacactgcccgaggaggaagactt
ccactcaaatggatggctcctgaatcattggcaacttatgagtactcttacaaaagcgac
gtatggtcttatggtgttcttctatgggagctattttctcttggagaagttccttatggc
gaagtacaaacgaccgaacttttacaaacgcatcgctcaggaaaacggctactgaaacct
gaatggtgtccagaggaaatttacgatgtgatgaggctatgctggcaagaactccccgac
gatcgtccggcattccagcaaacatgtgcggttcttgcacaaatgcttgaaaatgcaacg
gaaaactatggatatttgataccaaaacattttaataatcaaacacgggatccgtcggaa
caatgcgataatgtgtaa

DBGET integrated database retrieval system