KEGG   Caenorhabditis elegans (nematode): CELE_F08G12.2Help
Entry
CELE_F08G12.2     CDS       T00019                                 

Gene name
snrp-40.1
Definition
(RefSeq) Small Nuclear RibonucleoProtein homolog
  KO
K12857  Prp8 binding protein
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03040  Spliceosome
Module
cel_M00354  Spliceosome, U4/U6.U5 tri-snRNP
cel_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CELE_F08G12.2 (snrp-40.1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cel03041]
    CELE_F08G12.2 (snrp-40.1)
Spliceosome [BR:cel03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    CELE_F08G12.2 (snrp-40.1)
 Complex C
   U5 SnRNP specific factors
    CELE_F08G12.2 (snrp-40.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 181319
NCBI-ProteinID: NP_509886
WormBase: WBGene00008586
Ensembl: WBGene00008586
UniProt: Q19211
Position
X:complement(join(11298252..11298307,11298379..11299135,11299319..11299417,11299467..11299534,11299585..11299600))
Genome map
AA seq 331 aa AA seqDB search
MALVTSSGQQLVSSGFPQQTAQRFSNLMAPTMVLLGHEGEIYTGAFSPDGTCLATSGYDQ
KIFFWNVYGECENFSTIKGHSGAVMDLKFTTDSSSLVSCGTDKSVRVWDMETGTCARRFR
THTDFVNAVHPSRRGVTLVASASDDGTCRVHDMRTKEPVKTYTNRYQQTAVTFNDSSDQV
ISGGIDNVLKVWDMRRDEITYTLTGHRDTITGISLSPSGKFIISNSMDCTVRQWDIRPFV
PGQRSVGVFAGHNHNFEKNLLKCSWSPCERFITAGSSDRFLYVWETLSKKIVYKLPGHMG
SVNCTDFHPKEPIMLSCGSDKRVFLGEIDMS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgttacttcttcgggacagcaactggtcagctctggatttccacagcaaact
gcgcagagattctccaatttgatggcaccaacaatggttttgctaggtcatgaaggagaa
atttacaccggtgcattcagcccagatggaacatgcttagcgactagtggatacgaccag
aaaatcttcttctggaatgtatacggcgaatgcgagaacttttctacaatcaaaggacac
tcaggagcagttatggatttaaaattcaccaccgacagcagcagtttggtctcttgtgga
acagacaaaagtgttcgtgtctgggatatggaaaccgggacttgcgctcgtcgcttcaga
actcacacagactttgtgaacgccgtccatccgtctcgtcgtggtgtaactcttgtcgct
tctgccagtgacgatggaacatgtcgtgtgcatgatatgagaaccaaggaaccagtgaag
acttacaccaaccgataccagcagacagcagttacattcaatgattcttcggatcaagtg
attagtggtggaattgacaacgtgctcaaagtttgggacatgcgtcgtgacgagattact
tacactctgactggacatcgtgacacaattactggaatctctttgtcaccaagtgggaaa
ttcatcatttccaattcaatggattgcactgttcgacaatgggatattcgaccattcgta
ccaggacaacgttcggtgggagtttttgctggtcataatcacaatttcgagaagaacctt
ctcaaatgttcttggtcgccatgtgagagattcatcactgctggctcgtcggatcgtttt
ctctacgtctgggaaacactgtcgaaaaaaattgtgtacaagcttccaggtcacatggga
agtgtcaactgtaccgatttccacccaaaggaacctatcatgctctcgtgtggaagtgac
aaacgtgttttcttgggagaaatcgatatgagctag

DBGET integrated database retrieval system