KEGG   Caenorhabditis elegans (nematode): CELE_F08G5.5Help
Entry
CELE_F08G5.5      CDS       T00019                                 

Gene name
ugt-65
Definition
(RefSeq) UDP-glucuronosyltransferase
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 184205
NCBI-ProteinID: NP_502373
WormBase: WBGene00008583
Ensembl: WBGene00008583
UniProt: Q19222
Position
IV:join(12425229..12425368,12426891..12427123,12427364..12427498,12429884..12429944,12429990..12430080,12430941..12431309,12431604..12431906,12432314..12432511)
Genome map
AA seq 509 aa AA seqDB search
MPQYSQLITIIFLLAHFLTTSNCSRILFLNMFNSKSHALTMMPLAERLFDDGHDVSMYTI
SANRLKIPSKKVKILESLVKGSSTDDAAPDTGGVSRIFWSYEMTPYVGAWCYEIGLYYLE
EGRDEQLDEVLATPYDLAVVDETYTSLQGSIALKLKEDHSTKIITFATTELMPVASNMRG
YARNPVTVPNTFLLSSEVYEGNRFAFLTRTRRIFEYFIDQIYSGPVASLYSEASGKLLGL
TSATKSKTFQNSILTVNDFPDTFSFVQPRGNDLIRVGEHCYSSANLPSEFRDFVEDSMSK
GTIYVAMGSYLNLEDGPKGTVEAFIEALNYFKDYRVIWSHKGNVTGAKCHVKSVNWAPQK
ELLAHEKTVAFITHGGLKSAKEGVCSGVPMLFLPFYGDQPRNAHRFVTNGIAEALYKKAI
TSLDIQQKLEKLLVDPSYKNNVMKVLSYYLDAPISSLDLGAFHISQVLRRTESQYSKFKR
RSIFMNHLQYLNLDIFLVILVILFIVSKF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgccacaatattctcaactcataaccatcatctttctacttgctcattttctcaccact
tcaaactgctccagaatactatttttgaatatgttcaactcaaagagccacgcactaaca
atgatgccgttagccgagagattattcgacgatggacatgatgtgtcgatgtataccata
agtgcgaatcggttgaaaattccatcgaaaaaagtgaaaattttggagtctcttgtgaag
ggaagtagtacggatgacgcagcaccagacacgggcggtgtgagcagaatattctggagt
tatgaaatgacaccgtatgttggcgcatggtgttatgaaatcggtctgtactatttggaa
gaaggaagagatgaacaactagatgaagttcttgcaacaccgtacgacctggcagttgtt
gatgaaacttacacatcacttcaaggatcaattgccctaaaattgaaagaagatcatagc
acaaagatcataacatttgcaacgacagaactaatgccagttgcttcaaatatgagggga
tatgcaaggaatccggtgactgttccgaacacatttctgttgtcgtcggaggtttatgaa
ggaaatcggtttgcgttcttgacaagaactaggagaatatttgaatattttattgatcag
atttacagtggaccagttgcaagtctttacagtgaagcgtcgggaaaactacttggccta
accagtgcgaccaaaagcaaaacttttcaaaactcgatactcactgtcaatgatttcccg
gatacatttagtttcgttcaaccacgtggaaatgatttaattcgagttggagaacattgt
tattcaagtgccaatttaccatcagaattcagagatttcgtggaggattcaatgtcaaaa
ggtacaatctacgtagcaatgggatcctatttgaatttagaagatggtccaaaaggaaca
gttgaagcatttatagaagcattaaattattttaaagattatcgagtgatatggagtcat
aaaggaaatgtaaccggtgcaaaatgtcacgtaaaatcggttaactgggctcctcaaaaa
gagcttcttgctcatgagaaaacggtagctttcataacacacggtggcctaaaaagtgca
aaagaaggtgtctgctcgggtgttccaatgcttttcctaccattttacggtgatcaacca
agaaatgcacatcgatttgtaaccaatggaatagcggaggctctttacaagaaagcaata
acatcattggatattcaacaaaaattggagaaacttctcgtggatcccagttataaaaat
aatgtgatgaaggtcctatcctattacctcgacgctccgatcagttctctagacctcggt
gctttccatatctcacaagtgctccgccgtacagagtcacaatacagcaaattcaaacga
agatctatttttatgaatcacttacagtatctcaatcttgacattttcctggttattctt
gttattttatttattgtttctaaattttaa

DBGET integrated database retrieval system