KEGG   Caenorhabditis elegans (nematode): CELE_F09E5.5
Entry
CELE_F09E5.5      CDS       T00019                                 

Gene name
sec-6
Definition
(RefSeq) Exocyst complex component 3
  KO
K06110  exocyst complex component 3
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F09E5.5 (sec-6)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    CELE_F09E5.5 (sec-6)
SSDB
Motif
Pfam: Sec6 NPV_P10 IF-2 MnmE_helical
Other DBs
NCBI-GeneID: 173910
NCBI-ProteinID: NP_495006
WormBase: WBGene00017284
Ensembl: WBGene00017284
UniProt: Q19262
Position
II:join(5359561..5359671,5359729..5359841,5359889..5360183,5360237..5360332,5360680..5360747,5361071..5361377,5361429..5361674,5362216..5362308,5369133..5369226,5369277..5369347,5369811..5370019,5371185..5371409,5371461..5371581,5371632..5371973)
AA seq 796 aa
MDVDVEEAALEQVAALLQRPDQLEKLPELKKRADRKKLAVEAMLRTGVQGQLEGIRTAIA
HLQTASDDITAISQGVHDIRERLGPFPQLKEKLRELRDANARHGQYAAAMENLKHIFNLQ
TTLQEIRDALDDEKSGGNLLLAHKHIMDLERARDELLAEVHKMSGTNTEKEQMLLVNFFK
GVDSVVAELSKNMWFILGRTLEMVKGNEQGGGPQQVVTCLRIVEREERIDKFYMEARSKN
SSAFVPPGRPRNWKEKALRSLEKTVSNRVDGNQLEDRSLNKAWLARYLEVCKNVIMDDLQ
LAKVAIPCFPPDWQIYDRYVHMYHTSVCRRLREVASEHLEKSELVQLMSWIKFYASEDML
GHPKLRINAQAILQDSPVLSRSTLNQLCDQFVEMSRDDLKLWLKNTVSHETHDWYKNLRP
SEDNHGYFYTDLPNTVFGMLKDTVTLAKEVSVEVIPSIINLTIQEFNELAGKYRDAFTAY
KTDYFAERSKYQEFTSNIIAIANNLHTCIESTEKYKQQIRLSMEGEQNAAAAMTTPLASG
RRTAVRQQQLIENMDALNTKWSNAASVAVNYLREEVITDIAPSLVEIFSKKWLTGSAALE
TVCMTISDYYHDHKHLRPVTRSTLLMDLQFRIVSEYLKAIETKRVSLNSYEERALAGKRM
KADVVRLDNLYAEFATSSDMADQLPLLTSIVAAAGDVISLKDKSLLSLEATSFARKFPNC
PAELLSAVIATRDDISGSEARSLASEVLQHVQFHPKDQIFDQLFALRQQENSERLPNLGM
ANMFKADFMSMLKRDA
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggacgttgatgtggaagaggcggcattggagcaagtagcagctctactacaacgtcct
gatcaactggaaaaattgccggaactcaaaaagagagctgatagaaagaagctcgctgtc
gaggctatgctccgaactggtgttcaaggtcaattagaaggaattcgaactgcaattgct
catcttcaaaccgcttcagatgatattaccgctatttctcaaggagttcacgatattcga
gagcgtctcggaccatttccccaactgaaagagaaacttcgagaacttcgtgatgccaat
gctcgtcacggtcaatatgcagctgcaatggagaatttgaagcatattttcaatctacaa
acaacacttcaagaaattcgtgatgcgctggatgatgaaaagtctggaggaaatctgttg
ttagctcacaaacatattatggatttggaaagagctcgagacgaattgctggccgaagtt
cataaaatgagtggaacaaatacggaaaaagagcaaatgcttctcgtcaatttcttcaag
ggagttgactcggttgtcgccgaattgtcgaagaatatgtggtttattctcggtcgaact
ttggaaatggttaagggaaatgagcaaggtggcggaccgcaacaagttgtgacatgtctt
cgaattgtggaacgagaagaaagaatcgataaattctacatggaagctcgaagcaagaac
tcatcggcatttgttccaccaggccgacctcgtaactggaaagaaaaagccttacgatca
cttgagaagactgtctcaaatcgagtagatggaaatcaactcgaagatcgatctctgaac
aaagcgtggcttgctagatatttagaagtttgtaaaaatgtaattatggatgatttacaa
ttggcaaaagtggcgattccgtgtttcccaccggattggcagatttacgatcgatatgtt
cacatgtatcacacatctgtgtgtagaagactccgagaagtggcatcggaacatttggaa
aaaagcgagctggttcagttgatgtcatggatcaaattttacgcatctgaagatatgcta
ggacatccgaaactgaggatcaatgcacaggctatattacaagatagtcctgttctgtcg
agaagcactctgaatcaactttgtgatcaatttgttgaaatgtcgagagatgatctgaaa
ttatggctgaaaaatactgtttctcatgagactcatgattggtacaaaaacttgcggcca
agcgaggacaatcatggatatttctacactgatctgccaaatactgtttttggaatgctc
aaggacacggtgacattggcaaaggaggtatcagttgaagttattcctagcatcatcaac
ttgacgattcaagaattcaatgagttggcaggaaaatatagagatgcattcactgcttac
aagacggattattttgcggagaggagcaagtatcaagagtttacttctaatattattgca
atcgccaacaatcttcacacttgcatcgaatcaactgaaaagtataagcaacaaattcgt
ttatcaatggaaggagaacaaaacgcggcggctgctatgacaacgccactcgcatcagga
cgacgtactgctgttagacaacagcaactcatcgagaatatggacgctttaaatacgaaa
tggagtaatgcagcttcagtagcagtaaactatctccgagaagaagtcatcacagatatt
gctccaagtctcgttgaaatcttctcgaaaaaatggttaaccggaagtgctgctctcgag
acagtttgtatgactatttccgattattaccacgatcacaagcatctgcgaccagtcaca
aggtccactttgcttatggatcttcaatttagaattgttagcgaatatttgaaggcaatc
gaaacaaagcgagtgagtctcaattcgtatgaagagcgtgcacttgcaggaaagagaatg
aaagctgatgttgttcgtttggataatctttatgctgaatttgcgacaagttctgatatg
gctgatcagctcccactcctaacatcaattgtggctgcagctggagatgtgatttctcta
aaagacaaatctcttctgtcacttgaagccacttcatttgctcggaaatttccaaattgt
cctgctgaattgctttctgctgttattgcgactcgtgatgatattagtggcagtgaagct
cgtagtttggctagtgaagttctacaacatgtacagttccatccaaaggatcagatattc
gatcaactttttgctttgcgacaacaagaaaattcggaacgacttccaaatttgggaatg
gccaacatgttcaaagctgactttatgtcaatgctcaagagagacgcataa

DBGET integrated database retrieval system