KEGG   Caenorhabditis elegans (nematode): CELE_F10B5.3Help
Entry
CELE_F10B5.3      CDS       T00019                                 

Gene name
F10B5.3
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BTB zf-C2H2_4 zf-C2H2 zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 184285
NCBI-ProteinID: NP_495709
WormBase: WBGene00008640
Ensembl: WBGene00008640
UniProt: Q09534
Position
II:complement(join(8147363..8147693,8148360..8148489,8148536..8149148,8149630..8149865,8149910..8150015))
Genome map
AA seq 471 aa AA seqDB search
MEEDNQSPSPSESSIKTDYDAKIRVLYSTKNNKSEEESVFAHRLVLSTFSPLFQQLLQDA
TSSSTSTTSSTSSDDVISISLDLTAFPNALAAFKVILEALYTGDIKMKSVAANEVLAVSR
HCQISSLEPKIMSAVAPLPLNLANILNCSQSVPLNSNPFLQYTSPPIQNYLSSMISLWSN
PFFSALFGNTTGTPSLPFSPQSDTENSRTQSEGSSPRANSTSTPPTTDLEKIVPNDDKEG
WCRNKKYIEKVDGGFMCTVCRKIYGRYNSVSYHVTIYHRNPPIKCEENGCNFSTREARYI
HFHKYYRHHIPLPENIDLGSRKCPFCRHVSKSPAMLEKHIARHETDGTSGGTPGALKRAQ
SKKKIVPTMTTDVIDPNVSSIFAPTNPAGNIPIQCSLCPFSTHSTDLLFIHLAMQHAQEL
AQCSGLLADNSSETSTSSSSDGEPMITDIDLDVKPLIDQSLMLHLNTPLSN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagataaccaaagtcctagtccatcggaatcatcaattaaaactgattatgat
gccaaaattcgagtcttgtattccacaaaaaataataaatcagaagaagaatcagtgttt
gcccatcgtctagtcctttcaacattctctcccctcttccagcaattgctccaggatgcc
acgtcatcaagcacatctaccacatcttccacatcatcagatgacgtcatttcaatcagt
ttggatctaacagcgttcccaaacgcccttgccgcattcaaagtgatactggaagcgtta
tacactggtgatataaaaatgaaaagtgtcgcagcgaatgaggttctcgcggtatctcgt
cattgtcaaatatcgagtctggagccaaaaatcatgtcagcagttgctccattgccttta
aatctagccaatatactgaattgctcacaaagtgtacctttgaattcaaatcctttccta
cagtacacctcaccgccaattcaaaactatttgtccagtatgatcagtttatggagtaat
ccattcttcagtgcactttttggaaatacaactggtacaccaagtctgccattttcacca
caatcggatacagagaatagtagaacacaatcagaaggaagttcaccacgtgctaattca
acatcaactccaccaacaactgatcttgaaaagattgtaccaaatgatgataaagaagga
tggtgtcgaaataagaaatatattgaaaaagttgatggcggatttatgtgcactgtatgc
cgaaagatctatggacggtacaattcagtttcatatcatgttaccatttatcatagaaat
ccaccaattaaatgtgaagaaaatggatgtaacttttcaactcgtgaagcaagatatatt
cattttcataaatattatcgtcatcacattcctcttccggaaaatattgatttaggttct
cgaaagtgtccattctgtagacacgtctcaaaaagtcctgcaatgttggaaaaacatatt
gctcgacacgaaaccgatgggacaagtggtggcacaccaggcgcattgaaaagagcacag
agcaaaaagaaaattgttccaacaatgactactgacgtcattgatccgaatgtttcctca
atctttgctccaacaaatccagctggaaatattccgattcaatgctcattgtgcccgttc
tccactcactccacagatcttctgttcattcatttggcaatgcagcatgctcaggaactt
gcacaatgttcaggattacttgcagataattcttcagaaacatctacatcaagtagtagt
gatggtgaaccaatgataactgatattgatttagatgtgaaaccattaattgatcagtca
ttaatgcttcacttaaatactccattatctaattga

DBGET integrated database retrieval system