KEGG   Caenorhabditis elegans (nematode): CELE_F10C2.6
Entry
CELE_F10C2.6      CDS       T00019                                 

Symbol
dars-2
Name
(RefSeq) AA_TRNA_LIGASE_II domain-containing protein
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_F10C2.6 (dars-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_F10C2.6 (dars-2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_F10C2.6 (dars-2)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_F10C2.6 (dars-2)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     CELE_F10C2.6 (dars-2)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   CELE_F10C2.6 (dars-2)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CELE_F10C2.6 (dars-2)
 Prokaryotic type
   Other AARSs
    CELE_F10C2.6 (dars-2)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CELE_F10C2.6 (dars-2)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2b
Other DBs
NCBI-GeneID: 3565124
NCBI-ProteinID: NP_506019
WormBase: WBGene00001095
Ensembl: WBGene00001095
UniProt: P90831
Position
V:join(12048746..12048854,12048899..12049119,12049510..12049640,12049689..12049920,12049963..12050515,12050983..12051481,12052035..12052071)
AA seq 593 aa
MISARNVTAICCRRILSTSSYTVRTHICDELSTSNKNEKVSVMGWLSHKRMDRFFVLRDA
YGSVQAKISASSKLQSLLKDIPYESVVRVDGIVVDRGDNRNSKMKTGDIEIDVEELTVLN
KATSNIPMLPDANANERTRLKYRYIDLRSDKLQKSLRLRSEFVHNVRRFLVEKSGFVDVE
TPTLFRRTPGGAAEFVVPAPSPNQGLAYSLPQSPQQFKQLLMVGAIDRYFQIARCYRDEG
SKGDRQPEFTQVDVEMSFTTQNGVMQLIEDMIISAWPESLNHIKPKSPFPRIPYSDAMRL
YGIDKPDMRIPWQIDDVDNDIFEFLQKDIDDDTWRSRILVCRGAGKTTISNSMKNEWKRL
IQMNENGKNFAICHPSQKRWFKPFDNQKLIDQFGLIDEDVLIVCWGNSEGVYWTLEVCGL
RSKSNVTAHWIVDFPLFSFEEGQLVSTHHPFTAPLEKDIDILYSNDIDKLLQITGQHYDL
VINGVEMGGGSIRIENSEIQRHVLKVLGEPTDEMEHLLNALSHGAPPHGGFALGLDRFVA
MLTSDGNPLTPVRDVIAFPKTKNGKDLMSDAPATLSQKQLERYGISLLPNAVE
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgatatccgccagaaatgtcacagctatttgctgtcgaaggatattatcaacttcatct
tatacagtcagaacacatatatgtgatgagcttagtacttcgaataaaaatgaaaaagtg
agtgtaatgggatggctatcccacaaacgtatggatcgatttttcgttttacgcgatgct
tatggttcggttcaagcgaaaatatcagcatcttcgaagctgcagagccttttaaaggat
attccctatgaatcagttgttcgagttgatggaattgttgttgatcgtggagataatcgt
aacagtaaaatgaaaaccggagacattgaaatcgatgttgaagaactgacagtactcaat
aaagctacttcaaatattcctatgctaccggatgccaatgcaaatgaaagaactcggtta
aaatatagatacattgatttgagatctgataaattacaaaagagtttacgacttcgttca
gaatttgtgcacaatgttcggaggtttctcgttgaaaaaagtggatttgtagatgttgaa
acaccaactctatttcgtcgtactccaggtggagctgcagaatttgttgttccagcacct
tctccaaaccagggacttgcctattcattgcctcaaagtccacaacaatttaaacagctt
ttgatggttggagctatcgatagatattttcagattgcccgatgttatcgtgatgaagga
tcaaaaggtgataggcagcctgaatttacacaagttgatgtggaaatgtcatttacaaca
caaaatggagttatgcaacttattgaagatatgattatatctgcatggccggagagtttg
aaccatattaaacctaaatccccgtttccaagaataccgtattctgatgcaatgagactc
tatggaattgataaaccagatatgcgaattccgtggcaaattgatgacgttgataacgat
atatttgaatttttgcaaaaagatattgatgatgatacttggcggtcaagaattttagtt
tgtcgaggagctggtaaaacaacgatttcgaattcaatgaaaaatgaatggaaacgattg
attcagatgaatgagaatggaaagaattttgcaatttgtcatccgtcacagaaaagatgg
ttcaaaccgtttgacaatcagaaattgatcgatcaatttggattaattgatgaagatgtt
ctcattgtttgctggggaaattcagaaggggtttactggactttagaagtttgcggtctt
cgttcaaaaagcaatgtaactgctcactggattgtggattttccattgttctcatttgaa
gaaggacaacttgtatcaacacatcatccatttacggctccacttgaaaaagatattgat
attctttattccaatgatattgataaactcttacaaatcactggacaacactacgatctt
gttataaacggagttgaaatgggtggtggatcgattagaattgagaattcagaaatccag
cgacacgttctgaaagttcttggagaaccaactgatgaaatggaacatcttttaaatgca
ttatctcatggtgcaccaccacatggaggatttgctttaggacttgatagattcgttgca
atgcttacttccgatgggaatcctctcacaccagttcgagatgttattgcttttccaaaa
acaaaaaatggaaaagatttgatgagtgatgcgcctgcaacattatcccagaaacagcta
gaaagatatggaatctccttgttacccaacgctgtggaatga

DBGET integrated database retrieval system