KEGG   Caenorhabditis elegans (nematode): CELE_F10D11.1Help
Entry
CELE_F10D11.1     CDS       T00019                                 

Gene name
sod-2
Definition
(RefSeq) Superoxide dismutase [Mn] 1, mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04068  FoxO signaling pathway
cel04146  Peroxisome
cel04212  Longevity regulating pathway - worm
cel04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    CELE_F10D11.1 (sod-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CELE_F10D11.1 (sod-2)
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_F10D11.1 (sod-2)
   04213 Longevity regulating pathway - multiple species
    CELE_F10D11.1 (sod-2)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CELE_F10D11.1 (sod-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 172632
NCBI-ProteinID: NP_492290
WormBase: WBGene00004931
UniProt: P31161
Structure
PDB: 

Position
I:join(8434556..8434608,8434742..8434914,8434962..8435098,8435324..8435575,8435627..8435677)
Genome map
AA seq 221 aa AA seqDB search
MLQNTVRCVSKLVQPITGVAAVRSKHSLPDLPYDYADLEPVISHEIMQLHHQKHHATYVN
NLNQIEEKLHEAVSKGNVKEAIALQPALKFNGGGHINHSIFWTNLAKDGGEPSAELLTAI
KSDFGSLDNLQKQLSASTVAVQGSGWGWLGYCPKGKILKVATCANQDPLEATTGLVPLFG
IDVWEHAYYLQYKNVRPDYVNAIWKIANWKNVSERFAKAQQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaaacaccgttcgctgtgtctcaaagcttgttcaaccgatcacaggagtcgct
gctgttcgctcgaagcactcgctgccagatttaccatacgactatgctgatttggagcct
gtaatcagtcacgagattatgcaacttcatcatcaaaagcatcatgccacttatgtgaac
aatctcaaccaaattgaggaaaagcttcacgaggcggtctccaaaggaaacgtcaaagaa
gctatcgctcttcagccagctctcaagttcaatggaggaggacatatcaaccactccatc
ttctggactaatttggcaaaggacggaggagaaccatcggcggagttgctcaccgcaatt
aagagcgacttcggatctctggataatcttcaaaaacagctttcggcatcaactgtcgct
gttcaaggatcaggatggggatggttgggatactgtccaaagggaaagatcttgaaggtt
gccacatgtgccaatcaggatccacttgaggcaacaactggacttgttccactgttcgga
attgacgtctgggagcacgcttactacttgcagtacaagaatgttcgaccagattatgtc
aatgctatttggaagatcgccaactggaagaacgtcagcgagcgttttgcaaaggcacag
caataa

DBGET integrated database retrieval system