KEGG   Caenorhabditis elegans (nematode): CELE_F10D2.6Help
Entry
CELE_F10D2.6      CDS       T00019                                 

Gene name
ugt-37
Definition
(RefSeq) UDP-GlucuronosylTransferase
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 184293
NCBI-ProteinID: NP_504811
WormBase: WBGene00017332
Ensembl: WBGene00017332
UniProt: O16915
Position
V:complement(join(7142057..7142246,7142992..7143087,7143132..7143268,7143316..7143401,7143448..7143587,7143633..7144005,7144307..7144417,7144468..7144777,7145161..7145304))
Genome map
AA seq 528 aa AA seqDB search
MKILILLFACFNVNFSYNFLIFSPLFGHSHTTFFAKIADTLSEAGHNVTFFTPTIIRKFS
KINYVKHTKHVIHLEPSEKLERYGNQMEDVDISRFWTDDSSMAEMFPMIKLFNEMFAEQA
FVLGQNLDVLDELKEMKFDVMIFERFAECAYPLLEYLEIETFIPSSSLLFDPNLLISIGE
PRIPSTVPLPMSKFTDKMTMTERLLNAIAVPIFHSLLPTHEFKSFRPPYQAIDIQKMEHL
SSFILSNSNPYIDYPRPTLEKNVQIGGISVDVENLKIHKVNEEWDRILDMRQKTILVSFG
SVMLSKDMPVENKKILAKTMKQFPEVTFIWKYEFNDTDLFASETENIHFSSWVPQTALLA
DRRLTAFFTHAGLGSVNEVSYLGKPSIMCPIFADQMRNAKMLARHNGSIEISKYDLGNGE
KIEKTLRTILFDDSYRLSAEKLAHQLANQPVKPKELLLRHAEFAAQFGRLPSLDPYSRQL
SFVEYFLIDVAAILIFSSLLIVVVLFQIIKRLINFLPVTVDSRKVKTN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttattttactctttgcttgtttcaatgtaaatttttcttataattttcta
attttctctccattatttggtcatagccacacaactttctttgctaaaattgcggatact
ctttctgaagctgggcataatgtaacatttttcacacctacaatcatcagaaagttttcg
aagatcaactatgtgaaacacacaaaacacgtgatccacctggaaccctctgaaaagctg
gagcgatacggaaatcagatggaagatgtggatatatccagattttggactgatgactct
tcgatggctgagatgtttccaatgattaagctttttaatgaaatgtttgctgagcaagca
tttgtattggggcagaatctagatgtgctcgatgagctcaaagaaatgaaatttgatgta
atgatttttgaaagatttgcggaatgtgcatatcctctgcttgaatatctggaaattgaa
acatttattccatcgtcatcattgttatttgatccaaatttattaatatcaattggagag
ccaagaataccgagtacagtaccacttcctatgtccaaattcactgacaaaatgacaatg
accgagcggcttctcaatgcaattgctgttccaattttccattcgcttcttccaactcac
gaattcaaatcattccgccctccatatcaagccattgatattcagaaaatggaacatttg
agctcttttatactcagtaattccaatccatatattgactatccccgtccaacattggag
aaaaatgttcaaattggaggaatctcagttgatgttgagaatctaaaaatccacaaagtg
aatgaagaatgggatcgaattctagacatgcgacaaaaaactattctagtatcgtttggc
tctgtcatgctctcaaaagatatgccagtggaaaataagaaaattttggcaaagacaatg
aaacaatttcctgaggtaacatttatctggaaatacgaatttaatgatactgatttattt
gcaagtgagactgaaaatattcacttttcatcgtgggttccacaaactgctcttttagcc
gaccgccgtctaactgcatttttcactcacgcagggctgggaagtgttaacgaagtcagt
tacttgggtaaaccttcaataatgtgtccaatatttgctgatcaaatgagaaatgccaaa
atgttggcaagacataatggttcaattgagatctcgaagtatgatctgggaaatggagaa
aaaattgaaaaaactttgagaactattctgtttgatgattcatatcgattgtcagctgag
aaactagcacatcaactagcaaatcaacctgttaaacccaaggaattactgttaaggcat
gctgaatttgcagcacagttcgggcgtctaccatctttggatccatactctcgacaacta
tcttttgttgaatattttttgatcgacgtggcagccatcttgatattttcatctttgctg
attgttgtcgtcttgttccaaattataaaaaggctgatcaacttcctcccagtcacagtc
gattcacgcaaagtcaagactaattga

DBGET integrated database retrieval system