KEGG   Caenorhabditis elegans (nematode): CELE_F10G8.3Help
Entry
CELE_F10G8.3      CDS       T00019                                 

Gene name
rae-1
Definition
(RefSeq) mRNA export factor rae-1
  KO
K14298  mRNA export factor
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CELE_F10G8.3 (rae-1)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CELE_F10G8.3 (rae-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    CELE_F10G8.3 (rae-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 CNH Nup160
Motif
Other DBs
NCBI-GeneID: 172864
NCBI-ProteinID: NP_492650
WormBase: WBGene00003803
Ensembl: WBGene00003803
UniProt: Q93454
Position
I:join(10026644..10026751,10026796..10026888,10027752..10028585,10029642..10029728)
Genome map
AA seq 373 aa AA seqDB search
MFGSSGFGNKSMFGGSNISTSTTTPAANTTQNDDFLVDGAPEDTIQVIKFSPTPQDKPML
ACGSWDGTIRVWMFNDANTFEGKAQQNIPAPILDIAWIEDSSKIFIACADKEARLWDLAS
NQVAVVGTHDGPVKTCHWINGNNYQCLMTGSFDKTLRFWDMKNLPNQTQMAQIQLPERVY
AADVLYPMAVVALANKHIKVYNLENGPTEVKDIESQLKFQIRCISIFKDKSNQNPAGFAL
GSIEGRVAVQYVDVANPKDNFTFKCHRSAELVNGFQEIYAVNDICFHPQHGTLVTIGSDG
RYSMWDKDARTKLKTSEPHPMPLTCCDVHSSGAFLVYALGYDWSRGHEGNTQPGSKIVIH
KCIEDMKPRPTKK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgttcggatcgtcgggatttggcaataaatcgatgttcggaggatcgaatatttcaacc
tcgacaactactcccgctgccaacactacacagaatgatgactttctggttgatggagct
ccagaggacacaattcaggtcatcaagttcagccccacaccgcaagataaaccaatgctg
gcatgcggatcttgggacggtacaattcgagtgtggatgttcaatgatgccaacacattc
gaaggaaaagcacagcaaaacattccagctccaattctagatatcgcctggattgaagac
agttctaaaattttcatcgcatgtgctgacaaagaagctcgtctgtgggacctcgcttct
aatcaggttgcagttgtcggaacacatgatggaccagtgaagacttgtcactggattaat
ggaaacaactatcagtgtctgatgaccggatcattcgataaaactcttcgattttgggac
atgaagaatctaccaaatcagacacaaatggcacagattcaattaccggaaagagtttat
gcagccgatgtgctatatccgatggcagttgttgcactagctaacaagcatatcaaagtt
tataatctggaaaatggaccaacagaagtgaaagatattgaaagtcaattaaagttccag
atcagatgtatctcaattttcaaggataaatcgaatcaaaatcccgctggattcgctcta
ggatctattgaaggtcgagtagctgtacaatacgtggatgttgcaaatccaaaagacaac
ttcacattcaaatgtcatcgatcagctgaacttgtgaacggatttcaagaaatttacgct
gtcaatgatatttgcttccatccacaacacggaactctggtcacaattggttcagatggc
cgttattcaatgtgggacaaggatgcacggacaaagctgaagacatcagaaccacatcca
atgccgttgacatgctgtgatgttcatagttcgggtgctttccttgtctatgcattgggc
tatgattggagtcgaggtcacgaaggaaacactcaaccaggatcgaaaattgtaatccac
aaatgtatcgaagatatgaaaccacgaccgactaagaaataa

DBGET integrated database retrieval system