KEGG   Caenorhabditis elegans (nematode): CELE_F11G11.12Help
Entry
CELE_F11G11.12    CDS       T00019                                 

Gene name
col-73
Definition
(RefSeq) COLlagen
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen Col_cuticle_N
Motif
Other DBs
NCBI-GeneID: 184366
NCBI-ProteinID: NP_494880
WormBase: WBGene00000649
Ensembl: WBGene00000649
UniProt: P91250
Position
II:complement(join(4872217..4872263,4872316..4873126))
Genome map
AA seq 285 aa AA seqDB search
MSQDDKQKLVEVETVKKFAFFGIAVSTVATLTAIVAVPMLCMYMQNVQSGLQDEINFCRT
RSDSLRGEYTKLDQFRKAESREKRQTYQCCSCGIGPAGSVGNPGQDGAPGNDGRPGAPGA
PGPDAPNEHVQPTPADFCFECPPGPAGNAGNPGPKGPPGQPGAPGEQGPNGRPGAPGAPG
PQGPPGTAGNDGTPGQPGAPGQVRTVPAPPGNPGQPGEPGAQGPPGEDGRPGNSGPQGPP
GPQGEPGQDGAPGNPGAPGEAGEPGKDGAKGGCDHCPIPRTAPGY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagacgataagcaaaagcttgtggaggtcgagaccgtgaagaaattcgcgttc
ttcggaattgcagtctccactgttgccactttgacagctatcgttgcagtcccaatgctt
tgcatgtacatgcaaaacgttcaatccggacttcaagatgagatcaatttctgccgtact
cgttccgactctcttcgtggagaatacaccaagctcgatcaattccgtaaagctgagagc
cgtgagaagcgtcaaacctaccaatgctgctcttgcggaattggaccagctggatccgtt
ggaaacccaggacaagacggagccccaggaaatgacggaagaccaggagccccaggagcc
ccaggaccagatgctccaaatgagcacgttcaaccaactccagccgatttctgcttcgag
tgcccaccaggaccagccggaaacgccggaaacccaggaccaaagggaccaccaggacag
ccaggagcaccaggagagcaaggaccaaatggacgcccaggagccccaggagccccagga
ccacaaggaccaccaggaaccgcaggaaatgacggaactccaggacaaccaggagccccc
ggacaagtccgcaccgtcccagccccaccaggtaacccaggacagccaggagagccagga
gcccaaggaccaccaggagaggatggacgcccaggaaactcaggaccacaaggaccacca
ggaccacaaggagagccaggacaagatggagctccaggaaacccaggagcaccaggagag
gctggagagccaggaaaggacggagccaagggaggatgcgatcactgcccaatcccaaga
actgctccaggatattaa

DBGET integrated database retrieval system