KEGG   Caenorhabditis elegans (nematode): CELE_F14B8.1
Entry
CELE_F14B8.1      CDS       T00019                                 

Gene name
nhx-4
Definition
(RefSeq) Sodium/hydrogen exchanger
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Na_H_Exchanger DUF1761
Other DBs
NCBI-GeneID: 180964
NCBI-ProteinID: NP_001024562
WormBase: WBGene00003732
Ensembl: WBGene00003732
UniProt: G5EDU2
Position
X:join(6914375..6914378,6914943..6915023,6915337..6915445,6917328..6917482,6917839..6918454,6918569..6918772,6918818..6918933,6918984..6919192,6919238..6919379,6919428..6919518,6919605..6919849,6919896..6920030,6920363..6920505)
AA seq 749 aa
MRSQKTLLVILTLLLSYNVFCTGDTNGTLAQDPADQLLNTVPENFTNNIEYPQNNNNNTS
ETDESMDAEGEWVQSAPPEEIEEAKHLLDPVHVDFEHTHKPLAFVFLIILVTLAKPTLHW
PVLRKLPESVVLMLYGVLMATAVKALMRIDPGQLDTFMFFMILLPAIVNDAGLSMQKKEF
TIALPKILLFAVVGTVVHALLLAATMYGIEPIFSFKPGFLHLFVFATLISAVDPVSVLST
FAELDVKKSLFILIFGESLCNDAVTIVLYRTSINVIKTSDASDEMLTITSVVGSCVVQFM
IVCGFGLLCGAVVGFAGVFIMKNMVGHQMNQPIFQLFCPYLAYLLAETGHYSGILASILC
AAIMSYYMAANMCVEMEFAAFTFSKTGSSLSESCIFFYLGVSLVSYNHEFDFYFIAVTVF
CCTLYRFLVTCTLSAFYNLFASEKNRIPFTDQLVVTHAGIRGAVCFGLVQIIDERIIPAK
PYFVTTTLAMIFVTSILQGCTIKFVMKCLKIPGDDGTKQKDPKALRWLTHLNDKYIKKFL
VSENTYLPTDETFRNLGLPKAVSTALRIGERSHTDLQRHGEVSHTPAPSVGRPTIAPFDF
GNMEEENNRLPSTGRRTPVARSQTRYSRHFIYAIPNETDNYLTCPVSASKRPPFDPSQVY
QHQNTISNPGDDRARCYNRRHNSMSGADEMELKQLNQTVQKKLSRTITSGTKQFVVNPDE
AIREESPATIPKKRATFEDDEISKIDESE
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgcggagtcaaaaaactctgcttgtcatattgacgttgctgctaagctacaacgtcttc
tgtacaggggatacaaatggaactctagctcaagacccggccgatcaactcctcaacact
gtgccggaaaacttcaccaacaacatcgagtaccctcaaaacaacaacaacaacacctca
gaaactgatgaaagcatggacgccgaaggagaatgggttcaaagtgctccacccgaggag
attgaagaagccaagcatcttttggatccagttcacgtcgattttgagcatacccataag
ccactggcctttgtttttctcatcattctggtcactcttgccaagccaactcttcactgg
cctgtgcttcgaaaacttcctgaatcggtagtcctaatgctttatggagtcctaatggct
actgcagtgaaagctttgatgagaatcgacccgggacaactcgacacattcatgttcttc
atgatccttctccctgcaattgtaaacgacgctggactttcaatgcaaaaaaaagagttc
actattgcattgccaaaaatcttattgttcgctgttgtcggaactgtcgtgcacgctctt
cttcttgctgcaaccatgtacggaatcgagccaattttcagctttaagcctggattccta
catcttttcgtcttcgctacacttatcagcgcggtcgatcccgtatccgtgctgagcaca
tttgcagagcttgatgtcaagaaaagtttattcattctgattttcggagaatcactttgc
aacgacgccgttaccattgttctctaccgtacatcaatcaatgtcattaaaacttctgat
gcatccgatgagatgcttacaattacttcggtcgttggaagttgcgttgtacagttcatg
attgtttgcggattcggattgttgtgtggagcagttgttggatttgccggtgtgttcatc
atgaaaaatatggtcggtcatcagatgaatcaaccgatcttccaacttttctgtccatac
cttgcctacctccttgctgaaactgggcattattctggaattcttgcttctattctgtgt
gctgcaatcatgtcgtactatatggcggccaacatgtgtgttgaaatggaatttgccgca
ttcacgttctccaagaccggatcttcactatccgaatcctgcatctttttctacctcgga
gtttcccttgtctcgtacaaccacgaattcgatttctactttattgcggtcaccgttttc
tgttgcactctgtaccgttttcttgtcacgtgtacactgtctgctttctacaacctcttt
gcttctgagaaaaatcgtattccattcactgatcagttggttgtcactcatgccggaatc
cgtggagctgtctgcttcggtctcgttcagattattgacgaaagaatcatcccagccaag
ccgtactttgtcactaccacccttgccatgatcttcgttacatctattcttcagggttgt
accattaagttcgtcatgaaatgtctcaagattccgggtgacgatggaacaaaacagaag
gatccaaaagccttgagatggcttactcacctgaacgacaagtacatcaaaaaattcctt
gtatcggagaatacttatcttccaactgatgaaaccttccgcaacctgggacttccaaaa
gccgtcagtaccgctcttcgtattggtgaacgcagtcatactgatcttcaacgccacgga
gaagtctcccacaccccagcgccatccgtcgggcgaccaaccattgctccattcgatttc
ggaaatatggaagaagagaacaaccgtcttccatccaccggtagacgtactccagttgcc
agaagccaaactcgctactctcgtcatttcatctatgctattccaaatgagactgataac
tacttgacctgtccagtgagcgcatccaaacgtcctccatttgacccatctcaagtctat
caacaccaaaacaccatcagtaaccctggagacgatcgtgctcgttgctataaccgtcgc
cacaactcgatgagcggagccgacgagatggaactcaaacaacttaatcagacagttcag
aaaaaactttcccgcaccatcacaagtggaacaaagcagtttgttgtgaaccccgatgaa
gcaatccgtgaagagtctccagccactattccaaagaaacgtgccacatttgaagacgac
gagatttccaaaattgatgagagcgagtga

DBGET integrated database retrieval system