KEGG   Caenorhabditis elegans (nematode): CELE_F15A2.5
Entry
CELE_F15A2.5      CDS       T00019                                 

Gene name
efn-3
Definition
(RefSeq) Ephrin RBD domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Ephrin Fim-adh_lectin
Other DBs
NCBI-GeneID: 184508
NCBI-ProteinID: NP_510250
WormBase: WBGene00001164
Ensembl: WBGene00001164
UniProt: Q19475
Position
X:complement(join(13476101..13476186,13476280..13476462,13476512..13476596,13476647..13476724,13476951..13477062,13477352..13477443))
AA seq 211 aa
MSSSWALFLLLFVAPLVSCRNYHDVMWNSKQFPVAFKTTPIKVDLGDQLTIICPKAYGMT
YEYAKLYWVGETEWSQCWLHEPVWLGVCATENYTTEVKLIFRQTNPIPDGMDFQVGKTYY
IISTSTGDIEGINQAVGGLCKYHHMKLAISVVGYEKQSHSKSEITEKNFAHGIGYEIHEV
GQLVSSGHQNFTLLTTTSLLFCTMFLSGVLF
NT seq 636 nt   +upstreamnt  +downstreamnt
atgagctcaagctgggccctgtttctgttgctgttcgtggcgcccttagtctcgtgccgt
aattaccacgatgttatgtggaattccaaacagttcccggttgcgttcaaaaccacacct
attaaagttgatttaggggaccagttgacaattatctgtccaaaagcatacggaatgaca
tacgaatatgcaaaattgtattgggttggagaaacggaatggtctcagtgttggcttcac
gagccagtttggctcggagtttgtgcaaccgaaaattatacgacagaagttaaactaatc
ttccgccaaactaacccaatccctgacggtatggatttccaagttggaaaaacctactat
ataatttcgacttctactggtgatattgaaggcataaatcaagcagtcgggggactgtgt
aagtatcatcatatgaaactggcaatctcggtagttgggtatgaaaagcagtcgcattca
aaatccgaaatcactgaaaaaaactttgctcatgggatcggatacgaaattcatgaagtg
ggacaactcgtttcctcaggccaccaaaactttacgctcttgaccacaacgtcactactt
ttctgcacaatgttcttaagcggtgttttgttttag

DBGET integrated database retrieval system