KEGG   Caenorhabditis elegans (nematode): CELE_F16B4.8
Entry
CELE_F16B4.8      CDS       T00019                                 

Gene name
cdc-25.2
Definition
(RefSeq) M-phase inducer phosphatase cdc-25.2
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 178645
NCBI-ProteinID: NP_503446
WormBase: WBGene00000387
Ensembl: WBGene00000387
UniProt: O44628
Position
V:join(1577738..1577795,1582771..1582883,1582974..1583065,1583338..1583866,1583921..1584178,1584542..1584934)
AA seq 480 aa
MNRPSQISQDVAQPLSNQHETAMMSSDEDSMSRDSGICELMDENTPVCFSSMSTESTTVQ
VEECMEIDEDENLQPGPVSRRQKKVTFRREKSSCQVRLFDESPTSHKMFMRPQAPLSVRS
ENQQLLQQRKRKFEKSEQSSDHFHLEPMSVEAMDDDEIVMMDQNTTKWEPGFRAPNHKKG
RLTRSATAFPSLETFEEEEHEEQHHLNVKYHLKTVAKESSKGFRRITAETLRDIFFRLSE
KEFDDKYILIDCRYPYEYNRGHIKNAINHFDRVTVSKIFYDENGRKRCNKIPIFYCEFSQ
ARGPKMAYALRQVDRELNVNHYPKCDYEEMYVLDLGYRNFFFAANEANITNLCQPHAYCE
MHDKEHTMELKKYNFHNKGQSVLRTVSMSRSFKSLPTGSAFNFVASSASFTSAPSTSTEN
IDTNDDCQKSRTPAVPRIASRRNLFSDPSHSPTNFAQFPLTCSRETPSPHKHPLTCPRFS
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaataggccttcacaaatatcacaagatgtagcacaaccgctttctaatcagcatgaa
accgcgatgatgtcctccgacgaagattccatgtcacgcgactcggggatctgcgagttg
atggacgagaacacgccggtttgcttctcctcaatgtctacagagtcgacgaccgtccaa
gtcgaagagtgcatggaaatcgatgaggatgaaaatttacagccaggacctgtgtctcgc
cgccagaaaaaagtcacgttcagacgagagaagagctcctgccaggtgcgtctgttcgac
gagtcgcccacctcgcacaagatgttcatgcgcccgcaagccccgctgtcggttcgatcc
gaaaaccaacaactcctacagcagcggaaacggaagttcgagaagagcgaacaatcgtca
gatcatttccatttagagccgatgagcgtcgaggcgatggacgacgacgaaatcgtgatg
atggaccagaacaccaccaagtgggagccaggctttcgagcgccgaaccataagaaggga
cgtctcacccgttcagcaaccgccttcccgtcactagagacatttgaggaggaagagcac
gaagagcaacatcatctgaacgtgaaataccacctcaaaactgttgcaaaggaatcctcg
aaaggcttcagaagaatcaccgccgaaacattgagagacatctttttccgactctctgaa
aaagaatttgatgacaagtatattctcattgattgccgctacccatatgaatataatcgt
ggtcacatcaagaacgccatcaaccacttcgatcgggtcacagtgagcaagatcttctat
gatgagaatggccgaaagcggtgcaacaagattccgatcttctattgcgaattctcacag
gctcgtggtccaaaaatggcgtatgctcttcggcaagtagatcgagagcttaatgtgaac
cactacccaaaatgtgattatgaagagatgtatgtgctcgatcttggatatcgaaatttt
ttcttcgctgcgaacgaagccaatatcacgaatctctgccaaccccacgcatactgtgaa
atgcacgacaaggagcacacgatggagctcaagaagtacaacttccacaacaagggtcaa
tcggtactgcggactgtgagcatgagccgctccttcaagtccttgccgacgggttccgcg
ttcaacttcgtcgcctcatctgcttcgttcacctcggcaccgtccacgtcgacagagaac
attgataccaacgatgattgccagaaaagccggacgcctgccgttccgcggatcgcttcg
aggcgtaacttgttcagtgatccttcacactctccaacgaactttgcacaatttcctctg
acttgttcacgagaaacgccctctccccacaaacatcccttgacatgtcctcgtttttca
taa

DBGET integrated database retrieval system