KEGG   Caenorhabditis elegans (nematode): CELE_F16H9.1Help
Entry
CELE_F16H9.1      CDS       T00019                                 

Gene name
rgs-2
Definition
(RefSeq) Regulator of G-protein signaling rgs-2
  KO
K16449  regulator of G-protein signaling
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    CELE_F16H9.1 (rgs-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RGS LEDGF Transposase_24 SAICAR_synt
Motif
Other DBs
NCBI-GeneID: 181414
NCBI-ProteinID: NP_001024586
WormBase: WBGene00004345
Ensembl: WBGene00004345
UniProt: G5EFV0
Position
X:join(12712661..12712743,12725639..12725683,12726524..12726585,12726635..12726753,12727336..12727572)
Genome map
AA seq 181 aa AA seqDB search
MSCAISCFGKIIVCVTHNSSPSGKPYVSGSVSVEKKNQENDGPPTYEIVFGWSQSFENLM
KHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEV
SLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTVMGTFGIKEEA
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgtgcaataagttgttttggaaaaatcatcgtttgtgtcactcacaattcttca
ccaagcggtaaaccgtatgtcagcggaagcgtctcggtcgaaaagaaaaaccaggaaaac
gatggcccacccacttatgaaattgttttcggatggtcgcaatcttttgagaacctcatg
aaacaccgagctggacaaaagtactttgccgaattcttaaaaggagaatactcagatgaa
aacattcttttctggcaggcgtgtgaagagctcaaacgagagaaaaatgccgagaaaatt
gaagagaaggctcgcattatctacgaagatttcatctcgatcctttccccaaaagaagtt
tcgttagactctcgtgtccgtgaaatcgttaacaccaacatgggacgtccatctgcctcc
acctttgacgaggctcaaaaccagatctacacccttatgcaaagagacagctacccacga
ttcttggcctccaacatctacaagaccgtgatgggcaccttcggaatcaaggaggaagcc
gtttga

DBGET integrated database retrieval system