KEGG   Caenorhabditis elegans (nematode): CELE_F18E2.3
Entry
CELE_F18E2.3      CDS       T00019                                 

Gene name
scc-3
Definition
(RefSeq) Cohesin subunit scc-3
  KO
K06671  cohesin complex subunit SA-1/2
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_F18E2.3 (scc-3)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    CELE_F18E2.3 (scc-3)
SSDB
Motif
Pfam: STAG DUF86 Topo-VIb_trans
Other DBs
NCBI-GeneID: 179749
NCBI-ProteinID: NP_506193
WormBase: WBGene00004738
Ensembl: WBGene00004738
UniProt: Q19555
Position
V:join(12763945..12764042,12764090..12764497,12764551..12765629,12765865..12766151,12766199..12767388,12767443..12767671)
AA seq 1096 aa
MSETPTDQSPQRMSTRNQARVNYTDMAAGNNSVEKEPVFRSPTASTRGRKKRAANVDVAD
LSASFGNLNNFSTPPKRGRPRGGGLGSARGGRAPMVRRTTTEESAEVDDRELVAAVKSGK
KITEAVDRWIGRYNEKFLVAIAEMHQFFFAICGCKGIVTPQMSATLTYKDIICRMTEDFE
EDSADYPLVHGGSLKKVRANLHNFIHTLIIRTKASMLFDSNLMDGFVQLLTGMADSQVRA
FRHTATFCAMKITSALVDVTIELTQSKEKTSKQIEAEKAKLKNNSAGNEKYEALVAQRTQ
TEERAEEIRQIIGYLFRSVFVHRYRDVVPDIRCICIQELGHWMDVYPEHFVEDSYLKYIG
WSMFDKVGDVRQRCIRALIPLFEKTLILDKLELFVNKFKDRLVSMLLDKDLETSIETVHL
MRVLYTVFPTLLTIKDVVPIYELIYASNRPLAVAAGMFLNTKVFRSAEKPGKAPTAANIP
LVKDLTTFFIEGDLHQHATYLVDALFESNPIVKDWATMGELLINDQYQLDSNFETKLIEI
LTCSVVQSATGEPPVGRHIVKKGAPSAKESRDLVEDRQRLTETLIPLIPRLITKFSSDNE
KIINLVNIPLHFQLETYLSARMQTHLMELMEGLDSLIEKHLDEELLKAVAELYYHLTTNS
SISALVEGHKMKLLDGVAAFIRKSMQQFDDDQMGEEEEALFVSYIKRMAAFAGFMDLRHW
DLWDILLKVVSNYTREDTQRDVRERSMQMLFMQLCFDSMNIKKEGETPKADQVRKLKKRR
DQLIRIVTETLNEEACGVEQAYLVICDLMILFGSQLAEESKALEPLIWRPDAMVLGNLKI
FLDVNVFDVSNLDDMDQQEKIEVMHKMRQHVAQYAKLIIHGAMPVAEASHLIKRYQSHFQ
DFGDIFKNLLSKCREISFVETGVMICETLKTLYSQLDEDQGTDPLSESFNSIRDLAKRLG
PAFGVDYAKNRFAISSLHKKAIDFAFEEYDKENHQMPKNIFFLEIAIEFSGKLLAQDKMA
VVRYLNKIYTNRVGTSTVVWEPYRLYLGSLSDRNDDDNMSVRSGMTVTSNATMRSTASST
RGRGRGRGRSRIADDF
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgtcggagacacctacagatcagtcccctcagcggatgtccacgagaaaccaagcccgt
gtcaactacacggatatggcagctggaaacaattcagtagaaaaggagcctgtatttcgt
tcaccaacagctagcactcgaggacgaaaaaaacgagccgctaatgtcgatgttgcggat
ctttcggccagctttggcaatctgaataacttcagcacgcctccgaaacgcggccgtcca
cgaggtgggggtttaggaagtgcgcgtggaggaagagcaccaatggttcgacgaacgaca
acagaggaatctgctgaagtagatgatcgcgagcttgtagctgccgttaaatcaggaaag
aaaatcacggaagcggtagacagatggattggccgttacaacgaaaaatttctggttgca
attgccgagatgcatcaatttttcttcgcaatctgtggatgcaaaggaattgtcacacca
caaatgtcagcaactcttacctacaaagacatcatttgtcggatgacagaagattttgaa
gaggattccgctgactatccattagttcatggaggaagtctgaaaaaagttcgcgcaaat
cttcacaatttcattcatactctgatcatcagaaccaaagcgtcaatgcttttcgatagc
aatcttatggatggttttgtgcagttgctgactggaatggctgacagtcaagttcgtgca
ttccggcacacagcgactttttgcgctatgaagatcacatcagcgcttgttgacgtcacc
attgaacttacacagtcgaaagaaaaaacttcaaagcaaattgaagcagagaaggccaag
ctgaagaacaattcggctggaaatgaaaaatacgaggcacttgttgcacaaaggactcaa
acagaagaacgcgctgaagagattcgtcaaatcatcggatacttattcagaagtgtcttt
gttcatcgctatcgtgatgtggtaccagacattcgatgtatatgtattcaagaactcggt
cactggatggatgtttatccagagcattttgttgaggattcatatctcaagtatattggc
tggtcaatgtttgataaagttggtgacgtgagacaaagatgtattcgcgctttgattcca
cttttcgagaagacgttgattctggataaactagaattgttcgtcaataaattcaaagat
cgcctcgtttcaatgctacttgataaggatttagagacaagtattgaaactgttcacttg
atgcgtgttctctatacagttttccctactcttcttacaatcaaagacgtcgttccgatc
tacgagctgatctatgcttcaaatcgtccattagctgttgccgctggaatgttcttgaat
acaaaagtttttcgaagtgcagagaaaccaggaaaagcgccaactgctgcaaacattcct
ttggtgaaagatctcacgacgttcttcatcgaaggagatcttcatcaacatgcaacgtat
ttggttgacgcactttttgaaagcaatccaattgtgaaggattgggcgacaatgggagaa
ttattgattaacgatcagtatcaattggactccaacttcgagacaaaattaatcgagatc
cttacttgctctgtagtgcaatctgcaactggagagccccctgtaggaagacatattgtc
aagaaaggtgctccatctgccaaggaatcccgggatcttgtagaagacagacaaagactt
accgaaaccctcatccctctcattcctcgccttatcacaaagttcagctcggacaatgag
aaaattatcaatttggtcaacattccactgcactttcagttagaaacatacttatcagct
cgaatgcaaacgcatctcatggaactcatggaaggtctagactcattgattgaaaagcat
ctcgatgaagaattgctcaaagctgtagcagaattgtactaccacttgacaaccaactcc
tccatttctgctctcgtcgaaggccacaaaatgaaacttttggacggagttgctgctttc
attcggaaatctatgcaacaatttgatgatgatcagatgggggaagaagaggaagcactt
ttcgtatcctacataaaacgaatggctgctttcgctggattcatggatcttcgccattgg
gatctttgggacattcttctgaaagttgtttcaaactatacacgcgaagacacacaacga
gacgttcgagaaagatcaatgcaaatgttattcatgcaactttgctttgattcaatgaat
atcaagaaagaaggagaaactccgaaagcagatcaagttagaaaactgaagaaacgtaga
gatcagttaattcgaattgtaaccgaaacattgaacgaagaagcatgcggagtcgaacaa
gcttatttggtgatctgtgacctgatgatccttttcggaagtcaacttgcagaggagtcc
aaagctctggaaccactgatttggcgccccgatgcaatggttcttggaaatctcaaaatc
tttctggacgtaaatgtatttgatgtaagcaacttggatgatatggatcaacaagagaag
attgaagtaatgcacaaaatgcggcaacacgttgcacaatacgctaagcttatcattcac
ggagccatgccagtcgcagaagcatctcatctcataaaacgctatcagtctcacttccaa
gacttcggagacattttcaaaaatcttttatcaaagtgccgtgaaatttcatttgtcgaa
actggcgtcatgatttgtgaaactcttaaaaccctttattcacaattggacgaagatcaa
ggaacggatccactgtcagagtcattcaattctattcgtgatcttgcaaaacgattagga
cctgctttcggtgttgattatgctaagaatcggtttgctatctcgtcattgcacaaaaaa
gccatcgattttgcattcgaagagtacgataaagaaaatcatcagatgccgaaaaacatt
ttcttcttggaaattgctatcgaatttagcgggaagttattggcacaggacaagatggct
gtcgttcgttacttgaacaaaatttacacaaaccgcgttggaacatcaacagtcgtttgg
gaaccatatcgattatacctcggatcactctcggatcgtaacgatgatgacaacatgtct
gtgcgcagtggaatgaccgttacatccaatgcaactatgagaagtactgcttcgtcaaca
cgtggaagaggtcgtggaagaggtcgttccagaattgccgatgatttttaa

DBGET integrated database retrieval system