KEGG   Caenorhabditis elegans (nematode): CELE_F18H3.5Help
Entry
CELE_F18H3.5      CDS       T00019                                 

Gene name
cdk-4
Definition
(RefSeq) Cyclin-dependent kinase 4 homolog
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_F18H3.5 (cdk-4)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     CELE_F18H3.5 (cdk-4)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  CDK family
   CELE_F18H3.5 (cdk-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Haspin_kinase APH Kdo RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 181472
NCBI-ProteinID: NP_510256
WormBase: WBGene00000406
Ensembl: WBGene00000406
UniProt: Q9XTR1
Position
X:complement(join(13516051..13516309,13516416..13516576,13516809..13517228,13517289..13517351,13518779..13518904))
Genome map
AA seq 342 aa AA seqDB search
MCENLYGEEYKMEILRLQKMMNNMTCGQMAKPLTMKDFQIHQALGKGAYGNVYRVRSLHD
GKDYALKQIMISSKNEGIPQSVLREITVMKHLARKAHPNIISLKSVFHQLDPVRAILKIN
MIMERCDWDLHTFLRNIPRGVPEQQAKHVTAQIVRALDFLHTHSIIHRDLKPQNILLNRD
QTVKLADFGLSKEYSNTTAFTTLVVTLWYRSPEVLLQSYYNSTVDMWALGCIVSEIYCRQ
PLFVGQNEAEQLTDIFKKMGTPVGKDWPSESVIARDSFPQYRPTNLKDLSPQMSKQAIEF
VQQCLRYDHSKRLSARGALSHPFLKPAVATKSRVLKQINFNK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgagaatctttatggagaggagtacaaaatggagatccttcgactccaaaaaatg
atgaataatatgacttgcggacagatggcaaaacccttgacaatgaaggattttcaaatt
catcaggctcttggaaaaggcgcctatggaaatgtgtaccgtgttcgaagccttcatgat
ggaaaagactatgcactcaagcaaatcatgatttcttcgaaaaacgagggaatcccgcaa
agtgtgcttcgcgaaataacagtgatgaagcatctggcacgaaaagctcatccgaacatc
atctccttaaagtctgtttttcatcaacttgaccccgtgagagcaattctcaagataaat
atgataatggaaaggtgtgattgggatttgcacacgttcctgcgcaatattccacgcgga
gttccggagcaacaagcaaaacatgtcactgcacaaattgttcgagcactggattttctt
cacacacacagtatcattcatcgggatttgaagcctcagaatattctactcaacagagat
caaaccgtgaaattggctgattttggattgtcaaaagagtactcaaatacaacggctttc
acaacattagttgtcactctttggtatcgatcaccggaagttcttcttcaatcctactac
aacagtacagttgacatgtgggctctcgggtgcattgtatcggaaatttactgccgacag
ccactttttgtaggccaaaacgaggctgagcagttgacagacattttcaagaaaatgggc
accccagttggcaaggattggccgagtgaatctgtcatcgcccgagactcattcccacaa
tatcgcccgaccaacctcaaggatctgagcccgcagatgtcaaaacaggcaatcgagttt
gtgcaacagtgcctgagatatgatcattcgaagcgactttctgctcgtggagcattgagc
catccgttcttgaagcctgcggtggcaacaaaatctcgtgttctcaagcaaatcaacttc
aacaagtga

DBGET integrated database retrieval system