KEGG   Caenorhabditis elegans (nematode): CELE_F19B10.9Help
Entry
CELE_F19B10.9     CDS       T00019                                 

Gene name
sea-1
Definition
(RefSeq) T-box transcription factor 18
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 173710
NCBI-ProteinID: NP_494611
WormBase: WBGene00004750
Ensembl: WBGene00004750
UniProt: O02073
Position
II:complement(join(3672017..3672250,3672300..3672856,3673202..3673438,3673488..3673590))
Genome map
AA seq 376 aa AA seqDB search
MDTIININNNNQKYPQSAEEYHKVLCNYFITLQSAMQSTSRPSSSSPPSLPAVSSELLSS
SFPTNAPESSSRDLAPKQNQFTINVVLFDEKKKKNPEENLPANGDQLATLRSLMMQINPS
SPPSIPATSPQLPLAESENVPESSSTLKDHKFSLNTMLFNVKKNDAVKISLANQEQWAKF
HEIGTEMMVFNSGRRLFPLLAYKVSGLDPHKLYCAGVHMIPDSAYKQEYDHDLQQWVNCL
NQKKTIFKPTSEILGRIENGFKLMSLGIDMSDVKIFNIAIRKKTPLQIEKSRKPNLDKTI
EVLIQYKYLPVIKIYELSNSGMEKKEIAQATFPETSFVTVSIYRNQKIKEMKTLGNKYCR
TDRKQIVMEQRGELEQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatcatcaacatcaacaataataaccaaaaatacccacaaagtgcagaagaa
tatcataaagttctctgcaattactttatcaccttacaatcagcgatgcaatccacctcc
cggccgtcctcttcctcgcctccatcacttccagcagtgtcatcagagctcctttcatcg
agctttccaacaaatgctccggaatcttcatctcgagatttggctccaaaacagaaccaa
ttcacaattaatgtggtgctttttgatgagaagaagaagaagaatccggaggagaatttg
ccggcaaatggagatcagctggcaacgttgaggagtttaatgatgcaaatcaaccccagc
tcacctccatcaattccagccacgtcgccgcaactaccacttgctgaatctgaaaatgtg
ccggaaagctcctcaactctgaaagaccacaaattctcgctgaacacgatgcttttcaat
gtgaagaagaatgacgcggtgaagatctcgctggcaaatcaagaacaatgggcaaaattt
cacgaaatcgggacagagatgatggtgttcaattctggaagacgtctattcccactcctc
gcgtacaaagtctccggactggatccccacaagttgtactgcgctggagttcatatgatc
ccggactcggcttacaagcaagagtatgatcacgacctgcaacaatgggtgaactgtttg
aaccagaaaaagacgattttcaagccgaccagtgagattttgggccggattgagaatgga
ttcaaacttatgagccttggaatcgatatgtctgatgtgaagattttcaatattgcaatc
agaaagaagactccattgcagattgagaagagccggaagccgaacttagacaaaacgatc
gaagttctcatccaatacaagtacctcccggtgatcaaaatctacgagctgagcaactcg
ggcatggaaaagaaggaaattgctcaggcaacattcccggaaacctcattcgtgacggtg
tcaatctacagaaaccaaaaaatcaaggaaatgaagacacttggaaacaagtattgtaga
actgatcgcaagcaaattgtcatggagcaacgcggcgagctggagcaataa

DBGET integrated database retrieval system