KEGG   Caenorhabditis elegans (nematode): CELE_F20D6.4
Entry
CELE_F20D6.4      CDS       T00019                                 

Symbol
srp-7
Name
(RefSeq) SERPIN domain-containing protein
  KO
K13963  serpin B
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_F20D6.4 (srp-7)
Peptidases and inhibitors [BR:cel01002]
 Peptidase inhibitors
  Family I4: serpin family
   CELE_F20D6.4 (srp-7)
SSDB
Motif
Pfam: Serpin FANCI_HD1
Other DBs
NCBI-GeneID: 179195
NCBI-ProteinID: NP_001122924
WormBase: WBGene00005648
Ensembl: WBGene00005648
UniProt: A9Z1L1
Position
V:join(8179213..8179232,8181426..8181704,8181751..8181929,8181979..8182301,8182349..8182504,8182719..8182883)
AA seq 373 aa
MSDPKENMALLLQSETDFGLGLLRQQNISESLAFSPLSIALALSLVHVAAKGETRDQIRE
ALVKGSTDEQLEQHFANISAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAG
ASSLDFDNKEATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFK
KDSTFKSEFFSSADSKREIDFLHASSVSRDYAENDQFQVLSLPYKDNTFALTIFLPKTRF
GLTESLKTLDSATIQHLLSNVSSTSVNVQIPKWKIETKLGLEEALQSLGIKKAFDNDADL
GNMADGLYVSKVTHKALIEVDEEGTKAAAATTVSISLKSAMFVMEEPKDFTADHPFFFVL
SKDNHPLFVGLHH
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtcggatccaaaagaaaatatggcactacttctccaatcggagactgatttcggtctg
ggacttcttcgtcaacagaatatttccgaatctctcgcattttctccactttccattgcc
ttagctctatctctggttcatgtagcggcaaaaggagaaactcgtgatcagattcgtgaa
gctctcgtaaaaggatccaccgatgaacagctcgaacagcattttgcaaacatctccgct
gcactattggcggctgaaagaggaaccgaagtaaaacttgcgaatcatgtcttcactaga
gccggatttaaaatcaagcaatcgtacttagatgatgtcaagaaactttacaacgctggc
gcaagttcacttgattttgacaataaggaagctacggccgaagcgatcaataattttgtt
cgtgaaaatacaggagatcatatcaagaagattattggatcggacagtatcaactcagat
ctcgtcgctgttctcaccaatgctctctacttcaaggctgattggcaaaacaaattcaaa
aaggattctacattcaagagcgaattcttcagttcagctgattcgaaacgagaaatcgat
tttctccatgcctccagtgtctcgagagattacgccgaaaatgatcaattccaagttctc
agtcttccatataaggacaacacatttgcactcacaattttccttccaaaaacccgtttc
ggattgaccgagtcgctcaaaactctggattctgcaactattcaacaccttctatcaaat
gtctccagtacttcggttaatgttcaaattccaaagtggaagattgagacaaagttggga
ctcgaagaagctcttcaatcgctcggaattaaaaaagcgttcgataatgatgcagatctt
ggaaatatggcagatggcctctacgtttcaaaagtcactcacaaagctctcattgaggtt
gacgaagaaggaaccaaagccgctgcagctactactgtatcaatttcgctcaagtcagcc
atgttcgtaatggaagagccaaaagatttcacagccgaccatccattctttttcgttctg
tcaaaagataaccaccctctttttgtcggccttcatcattag

DBGET integrated database retrieval system