KEGG   Caenorhabditis elegans (nematode): CELE_F22B3.1Help
Entry
CELE_F22B3.1      CDS       T00019                                 

Gene name
his-64
Definition
(RefSeq) Histone H4
  KO
K11254  histone H4
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_F22B3.1 (his-64)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    CELE_F22B3.1 (his-64)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CENP-T_C CENP-S TAF CBFD_NFYB_HMF Histone Bromo_TP TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 178066
NCBI-ProteinID: NP_502154
WormBase: WBGene00001938
UniProt: P62784
Position
IV:11407116..11407427
Genome map
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtccggacgtggaaagggaggaaaaggccttggaaaaggtggtgccaagcgccatcgc
aaagttctccgagataacatccaaggtatcaccaagccagccattcgccgtctcgccaga
agaggaggagtcaagagaatctccggattgatctacgaggaaacccgtggagtcttgaag
gtgttccttgagaacgtcatccgtgatgctgtcacctactgcgagcacgccaagagaaag
actgtcaccgccatggacgtcgtctacgctctgaagcgccaaggaagaactctgtacgga
ttcggaggataa

DBGET integrated database retrieval system