KEGG   Caenorhabditis elegans (nematode): CELE_F22B3.4
Entry
CELE_F22B3.4      CDS       T00019                                 

Symbol
gfat-2
Name
(RefSeq) Glutamine-Fructose 6-phosphate AminoTransferase homolog
  KO
K00820  glutamine---fructose-6-phosphate transaminase (isomerizing) [EC:2.6.1.16]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00250  Alanine, aspartate and glutamate metabolism
cel00520  Amino sugar and nucleotide sugar metabolism
cel01100  Metabolic pathways
cel01250  Biosynthesis of nucleotide sugars
Module
cel_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_F22B3.4 (gfat-2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_F22B3.4 (gfat-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_F22B3.4 (gfat-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     CELE_F22B3.4 (gfat-2)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C44
   CELE_F22B3.4 (gfat-2)
SSDB
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 SIS_2 GATase_2
Other DBs
NCBI-GeneID: 178067
NCBI-ProteinID: NP_502156
WormBase: WBGene00009035
Ensembl: WBGene00009035
UniProt: Q19699
Position
IV:join(11410513..11411221,11411270..11411601,11411653..11412495,11412544..11412747,11412801..11412845)
AA seq 710 aa
MCGIFAYLNFLAPKKRSEIVDILVQGLQRMEYRGYDSAGIAIDGSNDIENPHSKIALLRK
RGKVSVLNDYIKENNEKLNMDMEYNIHCGIAHTRWATHGSPRDVNSHPHRSNDNNEFLVV
HNGIITNYREIKEYLEKKGHKFESETDTEVIAKLTQHVHDRYPDFSFRQLVETVIQQLEG
AFALAFKSSRFPGQLVASRRGSPLLVGIKSNSTLHTSHFPVSYSKGRCFMSNNATHLREE
TSFVETPNNILDLSIAVRNPSGSAKLPDNNSTTRPFDSTDFEVEYFIASDAAAIIEHTKQ
VLFLEDDDVAFVEDGSLTIHRISRHADSGEQKREVQLLELEIQEIMKGSYKTFMQKEIFE
QPESVVNTMRGRVLPSGQVVLGGLKEYLPAIKRCRRLIMVACGTSYHSAIACRQVLEELS
ELPVVVELASDFLDRETPIFRNDVCLFISQSGETADTLMALRYCKPRGALTIGVTNTVGS
SIGRESHCGIHINAGPEIGVASTKAYTSQIVSLLLFALTISEDRISKMKRRAEIIDALNN
LPILIRDVLDLDDQVLKIAEQIYKDKSLLIMGRGLNFATCLEGALKIKELSYMHCEGIMS
GELKHGPLAMVDEFLSICMVVCNDHVYKKSLNALQQVVARKGAPIIIADSSVPESDLAGM
KHVLRVPRTVDCVQNILTVIPLQLLSYHIAELNGANVDRPRNLAKSVTVE
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgtgcggaatctttgcctacctcaatttcctggctccgaagaagcggtcggaaattgtg
gacattttggttcaaggattgcagagaatggaatacagaggttacgactctgccggtatc
gccattgacggatcaaacgacatcgaaaatcctcattcgaagattgctctgctccgaaag
agaggaaaggtgtccgttctcaacgactacattaaggagaacaatgaaaagctcaacatg
gatatggaatacaatattcattgcgggattgcacacactcgttgggctacgcacggatca
ccacgtgatgttaattcccatccacatcgcagcaacgacaacaacgagttccttgtggtt
cataatggtatcattaccaattatcgcgaaatcaaggagtatctcgagaagaagggacac
aagttcgagtctgagacggatacggaagtcatcgcaaagctcacacagcatgtccatgat
cgttatcccgacttttcattccgtcagttagttgagacggttatccagcagttggaagga
gctttcgctttggcattcaagtcatcgcgtttcccaggacaacttgtggcttctagacgc
ggatctccactgttggttggtatcaagagcaactcaactcttcacactagccatttccca
gtctcttactcgaaaggacgctgttttatgtcgaacaacgccacgcatttgcgcgaagag
acatcgttcgtcgagactccaaacaacattctggatctttcaatcgctgtcagaaatccc
agtggatctgcaaagctgcccgacaacaattccacaacacgtccgttcgactcaaccgat
tttgaagttgaatacttcatcgcctcggatgcggctgcaatcattgaacacaccaagcaa
gttctgttccttgaggatgatgatgtggccttcgttgaagatggatcactcacaattcat
cgcatctctcgccacgctgacagcggcgaacaaaagagagaagttcagcttctcgagttg
gaaatccaagagattatgaagggatcttacaagaccttcatgcaaaaggagatcttcgag
caaccggaatcagttgtcaacacaatgcgcggacgtgttctcccatcgggacaagttgtt
cttggtggacttaaggaataccttccagctatcaaacgatgccgtcgcctcatcatggtt
gcgtgtggaacatcatatcactctgcaattgcttgccgtcaggttctcgaagaattgtcg
gaactgcctgttgtcgtcgaacttgcttcagatttcttggatcgtgagactccaatcttc
cgtaatgatgtgtgcttgttcatctcgcagagtggagagacggctgatactctgatggct
ttgagatactgcaaacctcgtggagctctcacaattggagttaccaacacagtcggatcg
tcgattggtcgcgaatcccactgtggaattcatatcaacgctggtccggaaataggagtt
gcttcaaccaaggcctacacctcgcagattgtatcacttctgttgttcgcactcaccatc
tcggaagatcgcatctcgaagatgaagagacgtgcagagattattgatgctctcaataat
cttccaattctgatccgcgatgttctcgatctggacgatcaggtactgaagatcgctgag
caaatctacaaagataagtcacttctcattatgggacgaggattgaactttgccacgtgt
ctcgaaggagctctcaagatcaaagagctctcgtacatgcattgtgaaggaatcatgtct
ggtgaactgaagcatgggcctcttgcaatggtcgatgaattcctcagcatctgcatggta
gtatgcaacgatcatgtctacaagaagtcgttgaatgctcttcagcaagttgttgcgcga
aagggagccccgatcattattgccgatagcagcgttccggaaagtgatctcgctggaatg
aagcatgttctccgtgtcccaagaacagtcgactgtgttcaaaacatcctcacggtcatt
cctctgcagcttctctcctaccacattgctgagctcaatggagcaaacgtggaccgacca
cgcaatttggcaaaatctgtcactgttgagtaa

DBGET integrated database retrieval system