KEGG   Caenorhabditis elegans (nematode): CELE_F22D6.3
Entry
CELE_F22D6.3      CDS       T00019                                 

Symbol
nars-1
Name
(RefSeq) Asparagine--tRNA ligase, cytoplasmic
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_F22D6.3 (nars-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_F22D6.3 (nars-1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_F22D6.3 (nars-1)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     CELE_F22D6.3 (nars-1)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   CELE_F22D6.3 (nars-1)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CELE_F22D6.3 (nars-1)
 Prokaryotic type
    CELE_F22D6.3 (nars-1)
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Other DBs
NCBI-GeneID: 172442
NCBI-ProteinID: NP_001021405
WormBase: WBGene00003815
Ensembl: WBGene00003815
UniProt: Q19722
Position
I:complement(join(7088190..7088537,7088583..7088744,7088790..7088964,7089017..7089489,7089536..7089931,7089974..7090057))
AA seq 545 aa
MSKLYIDTDAGSDQHPGTEAQPLATLVQAMLISKNSGEFLMKKKSEEGESWEPAAKAAIK
KAVKKYEAEVKKLEKAGCREKEAEEAQHAALEEAKKITFSLDKSLPEAKVIKIGESVQHR
DQRVSIKAWVHRLRRQGKSLMFLVLRDGYGFLQCVLNDKLCQSYDAVTLSTETSVQVYGI
IKALPDGKSAPDGHELTVDYWEVIGKAPAGGIDNVLNESAGVDVMLDNRHLVIRGENASR
ILRIRAAATRAMRDHFFAAGYTEVAPPTLVQTQVEGGSTLFGLDYYGEPAYLTQSSQLYL
ETCNAALGDVYCISQSYRAEKSRTRRHLSEYQHVEAECAFITFDQLMDRIEALVCDTVDR
LLADPVTKSLIEFVNPGYKAPARPFKRMPYKEAIEWLQKNDVRNEMGEKFVYGEDIAEAA
ERRMTDTIGVPILLNRFPHGIKAFYMPRCADDNELTESVDLLMPGVGEIVGGSMRIWKED
QLLAAFEKGGLDSKNYYWYMDQRKYGSVPHGGYGLGLERFICWLTDTNHIRDVCLYPRFV
GRCAP
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgtccaagctttacatcgataccgatgctggatctgatcagcatcccggaacagaagct
cagccattggctactttggttcaggctatgcttatttcgaaaaactcgggcgagttcttg
atgaagaaaaagtcagaggaaggggaatcgtgggaaccagcagcgaaagctgctatcaaa
aaggcagtgaaaaaatacgaagctgaagtgaaaaagctggagaaagctggttgtagggag
aaagaagccgaagaggctcaacatgctgctctcgaagaagccaagaagattacattttct
cttgacaagtctcttccagaagctaaggttatcaagattggagaatctgtgcagcatcgc
gatcaacgagtctcaatcaaagcctgggtacatcgtcttcgtcgtcaaggaaagtcactc
atgttccttgttcttagagacggttatggattccttcaatgtgttttgaacgataagttg
tgtcaaagttatgatgctgttactctctcaacagagacttctgttcaagtttatggaatt
atcaaggcacttcccgatggaaaatccgctcctgatggtcacgagcttaccgttgactat
tgggaggttattggcaaagcaccagctggaggaattgacaacgttctcaacgaaagcgct
ggagtcgatgtgatgcttgataaccgccaccttgtcatccgtggagagaatgcatcaaga
attcttcgtattcgcgctgcagctactcgtgcaatgagagatcatttctttgctgctgga
tatactgaagttgctcctccaactttggtgcaaacacaagttgagggtggttccactctc
tttgggcttgattattatggagagcctgcatacttgacacaatcttctcaactttatttg
gagacttgcaatgctgctcttggtgatgtttattgtatttcacagtcgtacagagccgaa
aaatcgagaactcgtcgccatctgtcagagtatcaacacgttgaggctgaatgcgctttt
atcactttcgatcaacttatggatcgcattgaggctcttgtttgtgatactgttgatcgg
cttcttgcagatccagtcaccaaatcgttgatcgagttcgtgaacccgggatataaggca
ccagcccgaccattcaagagaatgccatacaaggaagcaatcgaatggcttcagaagaat
gatgttcgcaacgagatgggagaaaagtttgtgtacggtgaagatattgctgaagctgct
gagagaagaatgactgataccattggagtgccaattcttctcaaccgtttcccacatgga
atcaaagccttctacatgccacgctgtgcagacgataacgagttgaccgagtccgtagat
cttttgatgccaggagttggagaaatcgttggaggatcaatgcgtatctggaaggaagat
cagttgttggctgcatttgagaaaggaggacttgactctaaaaactattactggtacatg
gatcaacggaaatacggaagtgtaccacatggtggatatggattgggactggagcgtttc
atctgctggttgaccgacaccaaccacatccgcgacgtctgtttgtacccgagatttgtc
ggcagatgtgctccgtaa

DBGET integrated database retrieval system