KEGG   Caenorhabditis elegans (nematode): CELE_F23F12.6Help
Entry
CELE_F23F12.6     CDS       T00019                                 

Gene name
rpt-3
Definition
(RefSeq) Probable 26S proteasome regulatory subunit 6B
  KO
K03063  26S proteasome regulatory subunit T3
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03050  Proteasome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    CELE_F23F12.6 (rpt-3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:cel03051]
    CELE_F23F12.6 (rpt-3)
Proteasome [BR:cel03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     CELE_F23F12.6 (rpt-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase Mg_chelatase AAA_14 AAA_33 AAA_28 AAA_18 NTPase_1 NACHT IstB_IS21 ATPase_2 TsaE TIP49 Sigma54_activat AAA_7 AAA_3 Zeta_toxin AAA_24 Prot_ATP_OB_N ATPase AAA_25
Motif
Other DBs
NCBI-GeneID: 175925
NCBI-ProteinID: NP_498429
WormBase: WBGene00004503
Ensembl: WBGene00004503
UniProt: P46502
Position
III:join(6489799..6490513,6490563..6490687,6490774..6491178)
Genome map
AA seq 414 aa AA seqDB search
MSAAALEEIGIAPLQENTSLRPPPLPATCVDVSSDDYIKLTTLERQLAHLQVMEDYIKLE
TRNLEKELLHAQEEVKRIQSVPLVIGQFLEAVDQNHAIVGSTTGSNYYVRVLSILDRELL
KPGCSVALHKYSNALVDVLPPEADSSIQMLRPDEKPDISYGDIGGLDMQKQEVREAVELP
LTHGELYQQIGIDPPRGVLMYGPPGCGKTMLAKAVAANTAASFIRVVGSEFVQKYLGEGP
RMVRDVFRLAKENSPSIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQSTN
VKVIMATNRQDTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTVCSRMNLSDDVDLEDWV
ARPDKISGADINSICQEAGMQAVRENRYVVLTKDLEKAYKNVVKKDTNDFEFYK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgctgctttggaggaaatcggtattgctccattacaggagaatacttctctc
cgtccgccaccacttccagccacctgcgttgatgtatcatcagacgactatatcaagctt
acaacgctggaacgtcaactggcgcatcttcaagttatggaggactatatcaagctggag
acaagaaaccttgaaaaagaattgcttcatgctcaggaagaagtgaagcgtattcaatct
gtgccacttgtcattggacaattcctggaagctgtggaccaaaaccatgctatcgttgga
agcaccaccggatccaactattatgtccgtgttctatcgattttggatcgtgagctgctt
aagccaggatgttcggtggcccttcataaatattcaaacgcacttgttgatgttcttcca
ccagaggctgacagctccattcaaatgcttcgtcctgatgagaaacctgacatctcttat
ggagatattggaggtcttgatatgcagaagcaagaagtcagagaagctgtcgaacttcca
ttgactcatggagaactttatcaacaaatcggaattgaccccccaagaggagttctcatg
tatggaccaccaggatgtggaaagactatgttggcgaaggctgttgctgcaaatactgct
gcttccttcattcgcgttgttggatctgagtttgtacagaaatatcttggagaaggacca
cgaatggtgcgtgacgtcttccgtctggcaaaggaaaacagcccatctattatttttatc
gatgaaattgacgcgattgctacgaaacgtttcgatgctcaaaccggagcagatcgtgag
gttcaacgtattcttctcgaattgctcaatcaaatggacggttttgatcaaagcactaat
gtgaaagttatcatggccactaatcgacaggatactctcgatcctgcacttcttcgtcca
ggtcgtctcgatcgtaagattgagttcccattgccagatcgtcgtcaaaagcgtctcgta
ttctcaaccgtctgctctcgtatgaacctgtcggatgatgttgatttggaagactgggtt
gctcgtccagacaagatttcaggagctgatatcaactctatctgtcaagaagctggtatg
caagccgttcgtgagaatcgttacgttgtgcttaccaaggatcttgagaaggcctacaag
aatgttgtgaagaaggataccaacgatttcgagttctacaagtaa

DBGET integrated database retrieval system