KEGG   Caenorhabditis elegans (nematode): CELE_F23H11.3Help
Entry
CELE_F23H11.3     CDS       T00019                                 

Gene name
sucl-2
Definition
(RefSeq) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00020  Citrate cycle (TCA cycle)
cel00640  Propanoate metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
Module
cel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CELE_F23H11.3 (sucl-2)
   00640 Propanoate metabolism
    CELE_F23H11.3 (sucl-2)
Enzymes [BR:cel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CELE_F23H11.3 (sucl-2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CELE_F23H11.3 (sucl-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 175252
NCBI-ProteinID: NP_497288
WormBase: WBGene00017759
Ensembl: WBGene00017759
UniProt: O02642
Position
III:complement(join(900281..900822,900931..901234,901280..901399))
Genome map
AA seq 321 aa AA seqDB search
MASTLASAARAATRAAVTRSVYNDTRNNLMINKSTKVIVQGFTGRQGTFHSKQMLEYNTN
LVGGVSPNKAGQTHLGLPVFGSVAEAKDRTGADATVIYVPAAGAARAIHEAMDAEIGLIV
AITEGIPQQDMVRVKNRLLKQNKSRLLGPNCPGIIASGDCKIGIMPGHIHKKGCIGIVSR
SGTLTYEAVHQTTTVGLGQTRCIGIGGDPFNGTNFIDCLEVFLEDEQTKGIILIGEIGGQ
AEEQAAEFLKSRNSGSNAKPVVSFIAGVTAPPGRRMGHAGAIIAGGKGTAGDKIEALRNA
NVVVTDSPAKLGVAMQKALLG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaactttggcatcggcggcccgtgctgctacccgtgcggcagtcacacgtagt
gtgtataatgacacccgtaacaacttgatgatcaacaaaagcaccaaagttattgtccag
ggtttcaccggacgtcagggaaccttccacagcaagcaaatgctcgaatacaacacgaat
cttgttggaggagtctcgccgaacaaagccggtcaaacgcatctcgggcttcccgtgttc
ggatccgtcgcagaagcgaaagaccgcactggagccgacgctactgtcatctatgttcct
gccgcaggagcagctcgtgcaattcacgaggctatggatgctgaaattggcttgattgtg
gcaatcactgaaggaattccgcagcaagatatggtccgcgtcaagaatagacttttaaaa
caaaacaaatctcgtctacttgggccaaattgccctggaatcattgcatctggagattgc
aagattggaatcatgccagggcatattcacaagaagggttgcatcggaattgtgtcccga
tcgggaactctaacctacgaagctgttcatcaaacaactaccgtcggacttggacaaacg
cgttgcattggaatcggaggtgatccgttcaacggaactaacttcattgattgtttggaa
gtgttcttggaggacgaacaaactaaaggaatcattctgatcggagaaatcggaggacaa
gccgaggaacaagccgccgagttcttgaaatctcgcaactctggttccaatgccaagcca
gttgtttcgttcatcgctggagtcactgctccaccaggtcgtagaatgggacacgccgga
gctatcatcgctggtggaaagggtactgctggcgataagatcgaggctcttcgcaatgcg
aatgtggtggtgactgatagtcctgcaaagcttggtgttgccatgcagaaagctcttctc
ggctag

DBGET integrated database retrieval system