KEGG   Caenorhabditis elegans (nematode): CELE_F23H12.1
Entry
CELE_F23H12.1     CDS       T00019                                 

Gene name
snb-2
Definition
(RefSeq) V-SNARE coiled-coil homology domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
Motif
Pfam: Synaptobrevin MCU MgtE DUF4566 DUF2207 Pox_A9 Integrase_H2C2 DUF2937
Other DBs
NCBI-GeneID: 179692
NCBI-ProteinID: NP_506093
WormBase: WBGene00004898
Ensembl: WBGene00004898
UniProt: Q19767
Position
V:complement(join(12344462..12344530,12344860..12345000,12345773..12345907))
AA seq 114 aa
MSANNEANKDLEAGNGEAQPPTGTYNTKRMQMAQAQVNEVIDVMRNNVNKVMERDVQLNS
LDHRAEVLQNGASQFQQSSRTLRQKYWWQNIRMMIIIGLIAFLVIGIFLIWIFN
NT seq 345 nt   +upstreamnt  +downstreamnt
atgtctgcaaataacgaagcaaataaagatttagaagctggaaatggtgaagctcaaccg
ccaacaggtacttataacactaaacgcatgcaaatggctcaagctcaagtcaacgaagtc
attgatgtgatgagaaacaatgtgaacaaggttatggaacgtgatgttcagctgaactct
ttggatcatcgcgccgaagttcttcagaacggagcatctcaattccaacagtcttcccgt
actcttcgtcagaaatactggtggcaaaatattcgaatgatgatcatcattggactcatc
gcattcctagtaattggaatcttcctaatctggattttcaactga

DBGET integrated database retrieval system