KEGG   Caenorhabditis elegans (nematode): CELE_F25B4.1Help
Entry
CELE_F25B4.1      CDS       T00019                                 

Gene name
gcst-1
Definition
(RefSeq) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00260  Glycine, serine and threonine metabolism
cel00630  Glyoxylate and dicarboxylate metabolism
cel00670  One carbon pool by folate
cel01100  Metabolic pathways
cel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CELE_F25B4.1 (gcst-1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CELE_F25B4.1 (gcst-1)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CELE_F25B4.1 (gcst-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CELE_F25B4.1 (gcst-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 178960
NCBI-ProteinID: NP_504502
WormBase: WBGene00017765
Ensembl: WBGene00017765
UniProt: Q22968
Position
V:join(5712943..5713016,5713118..5713303,5713360..5713964,5714273..5714616)
Genome map
AA seq 402 aa AA seqDB search
MNRLVSRSTLLNASRCFSRTAEASAKQTCLIETHKKHGGKLVEFAGYDMPTQYADFSIKE
STIHTRKHVSLFDVSHMLQTYITGKDRVAFIESLTTADVQGLQENSGTLSVFTNEKGGIK
DDLIIMKTDKDFLFLVTNAGCIEKDLPYLQENAAAWRSKGKDVKIETLDNRGLVAVQGPE
MAKVLQEGTDIDLSKLTFMKTTVGKVFGIDGCRVTRCGYTGEDGVEISVDPTKAEQLVER
LLASQAGSVKLAGLGARDALRLEAGLCLYGSDIEENTTPIEAGLAFVVAKRRRETLDFPG
AEHIVKQLKEKSWPKRRVGLLAPAGRCPRSHLPLIDPLDKCSIGFVTSGCPSPTLGKNIA
IAYVDKSHSKIGTKFVVDFGAKQAPVEVVKMPFVPTNYFTGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgattggtttctagatccacactgctcaatgcgtcgcgctgcttctccaggact
gctgaagcgtctgcaaaacagacatgtctaatcgagacacataagaaacatggaggaaaa
cttgtggagtttgccggctacgacatgccaactcagtacgctgacttttccatcaaagaa
tccacgatccacacaagaaagcatgtcagtttgttcgatgtgtcgcatatgctccaaact
tatatcactggaaaagatagagtagccttcatcgaaagcttgacaactgcagatgttcaa
ggactacaggagaatagcggaactctttcagttttcactaacgaaaaaggaggaattaag
gatgatttgatcatcatgaaaactgacaaagatttccttttccttgtcaccaacgctgga
tgcatcgaaaaagatcttccatatcttcaagaaaacgcggcggcctggaggtcaaaagga
aaagacgtcaaaatcgagacccttgacaatcggggacttgtcgccgttcaagggcctgaa
atggccaaagttttgcaagagggaactgatattgatctatcaaagctcactttcatgaag
acaactgttggaaaagtgttcggaatcgatggatgtagagttacaagatgtggatatact
ggagaagatggtgtagagatttccgtggatccaacaaaagccgaacaactcgttgagcgt
cttcttgcttcacaagctggcagtgtgaagcttgccggactcggagctcgtgatgctctt
cgtttggaagcaggtctctgtctttatggatctgatatcgaggaaaacacaacaccaatc
gaggctggtctcgcttttgttgttgccaagcgtcgtcgtgagaccctggatttccctgga
gctgaacatattgtgaagcagctgaaagagaaaagttggccaaaacgccgtgttggtctc
cttgcaccagccggtagatgccctcgatctcatctaccactcatcgatcctctcgataag
tgttccatcggatttgtaacttctggatgcccatcgccaactctcggaaagaacattgca
atcgcctacgtcgacaaatcgcattcaaagatcggaaccaagttcgtcgtggatttcggc
gccaagcaggcgccagtagaagtcgtcaaaatgccatttgttccgacaaattattttact
ggaaagtaa

DBGET integrated database retrieval system